KEGG   Rattus norvegicus (rat): 108348165Help
Entry
108348165         CDS       T01003                                 

Gene name
NEWGENE_2813, Hoxa2
Definition
(RefSeq) homeobox A2
  KO
K09302  homeobox protein HoxA/B2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    108348165 (NEWGENE_2813)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    108348165 (NEWGENE_2813)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain
Motif
Other DBs
NCBI-GeneID: 108348165
NCBI-ProteinID: XP_008761158
RGD: 11468112
Ensembl: ENSRNOG00000005968
UniProt: G3V6R6
Position
4q24
AA seq 372 aa AA seqDB search
MNYEFEREIGFINSQPSLAECLTSFPPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLN
PGSHPRQSAGAGGRPKSSPAGSRGSPVPARALQPPEYPWMKEKKAAKKTALPPAAASTGP
ACLGHKESLEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTE
RQVKVWFQNRRMKHKRQTQCKENQNSEGKFKNLEDSDKVEEDEEEKSLFEQALSVSGALL
EREGYTFQQNALSQQQAPNGHNGDSQTFPVSPLTSNEKNLKHFQHQSPTVPNCLSTMGQN
CGAGLNNDSPEALEVPSLQDFNVFSTDSCLQLSDALSPSLPGSLDSPVDISADSFDFFTD
TLTTIDLQHLNY
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgaatttgagcgagagattggttttatcaatagccagccgtcgctcgctgag
tgcctgacatcttttccccctgtcgctgatacatttcaaagttcatcaatcaagacctcg
acgctttcacactcgacactgattcctcctccttttgagcagaccattcccagcctgaac
ccgggcagtcaccctcgccaaagcgctggcgctggcggccgccccaagtcgagccccgcg
ggcagtcgcggcagcccggtgcccgcccgcgccctgcagccgcctgagtacccctggatg
aaggagaagaaggcggccaagaaaaccgcgctgccgcccgccgccgcctccacgggccct
gcctgcctcggccacaaagaatccctggaaatagccgatggcagcggtgggggatccagg
cgtctgagaactgcttacaccaacactcagcttttggaactggaaaaggaatttcatttc
aacaagtacctctgcagaccccggagggtggaaatcgccgcgctgctggatttgaccgag
agacaagtgaaagtgtggtttcagaaccggaggatgaagcataagaggcaaacccagtgc
aaggagaaccaaaacagcgaagggaaatttaaaaacctggaggattcggacaaagtggag
gaagacgaggaagagaagtcactctttgagcaagccctcagtgtctccggggcccttctg
gagagggaaggttacacttttcagcaaaacgcgctctctcaacagcaggctcccaatgga
cacaatggcgactcccaaactttcccagtttcgcctttaaccagcaatgagaaaaatttg
aaacattttcagcaccagtcacccactgttcctaactgcttgtcaacaatgggccagaac
tgtggagctggcctaaacaatgacagtcccgaggccctcgaggtcccctctttgcaggac
tttaatgttttctccacagattcctgcctgcagctttcagacgcactgtcgcccagtttg
ccaggctccctggacagtcctgtagatatttcagctgacagctttgacttttttacagac
acactcaccacaatcgacctacagcatctgaattactaa

DBGET integrated database retrieval system