KEGG   Rattus norvegicus (rat): 108348168Help
Entry
108348168         CDS       T01003                                 

Gene name
Rlim
Definition
(RefSeq) ring finger protein, LIM domain interacting
  KO
K16271  E3 ubiquitin-protein ligase RLIM [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    108348168 (Rlim)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     108348168 (Rlim)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    108348168 (Rlim)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_2 zf-rbx1 zf-RING_11 zf-C3HC4_2 zf-C3HC4 zf-RING_5 zf-ANAPC11 zf-C3HC4_3 Prok-RING_4 zf-RING_UBOX Zn_ribbon_17 zf-RING_4 zf-RING-like
Motif
Other DBs
NCBI-GeneID: 108348168
NCBI-ProteinID: XP_006257211
Ensembl: ENSRNOG00000045695
UniProt: Q4V889
Position
Xq22
AA seq 603 aa AA seqDB search
MENSDSNDKGSDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTE
EELLRRLQQIKEGPPPQSSDENRAGESSDDVSNSDSIIDWLNSVRQSGNTTRSGQRGNQS
WRAVSRTNPNSGDFRFSLEINVNRNNGSQTSENENEPSTRRLSVESMESSSQRQMESHAS
ESTSARPSRAERNSTEALEVPLTRGQRRARSRSPEHRRTRARAERSRSPLHPTIEIPRRA
HHNISPQTLEQPLENEPEGSSRTRHHVTLRQQISGPELLGRGLFAASGSRNPSQGTSSSD
TGSNSESSGSGQRPPTIVLDLQVRRVRPGEYRQRDSIASRTRSRSQTPNNTVTYESERGG
FRRTFSRSERAGVRTYVSTIRIPIRRILNTGLSETTSVAIQTMLRQIMTGFGELSYFMYS
DSDSEPSASVSSRNTERAESRNGRGSSGAGNSSASSSSPSPSSNGESSESSSDLFEGTSE
GGPSGPSRRDGRHRAPVAFDESGSLPFLSLAQFFLLNEDDEDQPRGLTKEQIDNLAMRSF
GENDALKTCSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLSSGNRE
SVV
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggagaactcagactctaacgataaaggaagtgaccagtctgcagctcagcgcagaagc
cagatggatcgattggatagggaagaggctttctatcagtttgtaaataatctcagtgaa
gaagattatagacttatgagagacaacaatttgctgggcaccccaggcgaaagtactgag
gaagagttgctcagaagactacagcaaattaaagagggtccaccaccacagagctctgat
gaaaatagagctggagagtcttcagatgatgtgtccaacagtgattctataatagattgg
cttaattctgtcagacaaagtggaaatacaacaagaagtggtcagagaggaaaccagtcc
tggagggcagtgagccggactaatccaaacagcggtgatttcagattcagtttagagata
aatgttaaccgtaataatggaagccaaacctcagagaatgaaaatgaaccatccactagg
cgtcttagtgtagaaagcatggaaagcagcagccaaaggcaaatggaaagtcatgcatct
gaatcaacatctgccagaccatctagagcagaacgcaattcaactgaagcattagaagtg
ccattgaccaggggtcagaggagggcaagaagccggagcccagaacatcggagaaccaga
gcaagagctgaaagaagtaggtcacctctgcatccaacaattgaaattccacgaagagct
caccataatatctcacctcagaccttggagcagcctttggaaaatgagcctgaagggagt
tctagaacccggcaccacgtgactctgagacagcagatatctggaccggagttgttaggt
agaggtctttttgcagcttctggatcaagaaatccctctcaggggacaagttcttcagac
acaggtagcaatagtgaatcatcaggatccggtcaaagacctccaaccatagttcttgat
cttcaagtaagaagagttcgtccaggagaataccgccagagagatagtatagctagtaga
actcgatcaagatctcagacgccaaacaacacagttacttatgaaagtgaacgtggaggt
tttagacgtaccttttcccgttctgaacgtgccggtgtgagaacctatgtcagcactatc
aggattcctattcgtagaatcttaaatactggattaagtgaaactacatctgtggcaatt
caaaccatgttaaggcagataatgacaggttttggtgagctaagctactttatgtacagt
gacagtgattcagagcctagtgcctcagtttccagccgaaatacagagagagcagaatca
cggaatggaagagggagctccggtgctggtaacagctctgcttccagctcaagccctagc
cctagttcaaatggtgaaagttcagaaagtagctcagatctgttcgaaggcactagtgaa
ggaggcccatctggcccatccaggagagatggtcgacatagggctccagtcgcatttgat
gaaagtggctctctgccattccttagtctggctcagttttttcttttaaatgaggatgat
gaagaccaacctagaggactcaccaaagaacagatcgataacttggcaatgagaagcttt
ggtgaaaacgacgcattgaaaacatgtagcgtttgcattacagaatatacagaaggcaac
aaactccgtaaactaccttgctcccatgagtaccatgtccactgcatcgaccgctggttg
tcagagaattccacctgtcccatctgtcgcagggctgtcttatcttctgggaacagagag
agcgttgtgtaa

DBGET integrated database retrieval system