KEGG   Rattus norvegicus (rat): 108348250Help
Entry
108348250         CDS       T01003                                 

Definition
(RefSeq) cullin-7
  KO
K10613  cullin 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    108348250
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    108348250
   03036 Chromosome and associated proteins [BR:rno03036]
    108348250
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul7 complex
    Cullin
     108348250
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   3M complex
    108348250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cul7 Cullin ANAPC10 Cullin_Nedd8
Motif
Other DBs
NCBI-GeneID: 108348250
NCBI-ProteinID: XP_006226802
RGD: 11406442
UniProt: A0A0H2UHP4
Position
9q12
AA seq 1698 aa AA seqDB search
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHNGHPEYQIRWLILRRGDDGDSSQVDCKA
EHILLWMTDDEIYANCHKMLGEDGQVIRPSQESAEAGALDKSVLGEMETDVKSLIQRALR
QLEECVGAVPPAPLLHTVHVLSAYASIEPLTGVFKDRRVLDLVMHMLSSPDYQIRWSAGR
MIQALSSHDAGTRTQILLSLSQQEAIEKHLDFDSRCALLALFAQATLTEHPMSFEGVQLP
QVPGRLLFSLVKRYLCVTFLLDRLNGNAEDQDAQNNFIPEELNAGRGRVELEFSMAMGTL
ISELVQAMRWDWASSRSESSSPIFQPPPTEFFRPRAQRFRRSRRFRPRTAFASVNTYALY
VRDTLRPGMRVRMLEDFEEISAGDEGQFRQSNDGMPPVQVLWDSTGHTYWVHWHMLEILG
FEEDIEDVVDIDDQGAMVHGGLGVAPPFQHWKPIAQLFAEPYVVPEEEDREEREHLTQAE
WWELFFFIKKLNAEERQHVVELLQEFLEGEHVLDFEILPELTVPVELAQDLMLSLPQQLD
DSALRDLFNCYVYRKYGPEVLVGKRNRPFVLDDQLNLFRIETDSEDEAGAEAQDPPSQSA
SPALRQLVEGLGPSGKLLVDLERALSSEAPQENEVKPCLLQLQEEPQPFLTLMRSLDTPA
SNKALHLTALRILMQLVNFPEALLLPWHEAMDACMTCLRSPNTDREVLQELIFFLHRLTS
TSRDYAVILNQLGARDAISKVLEKHRGKLELAQELRDMVFKCEKHAHLYRKLTTNILGGC
IQMVLGQIEDHRRTHRPIQIPFFDVFLRYLCQGSSAEVKKNKYWEKVEVSSNPHRASRLT
DRNAKTYWESNGTAGSHFITVHMRPGVLIRQLTLLVAGEDSSYMPAWVVVCGGDSISSVN
TELNAVNVMPHASRVILLENLTRFWPIVQIRIKRCQQGGINTRIRGLEVLGPKPTFWPVF
REQLCRHTRLFYMVRAQAWSQDIAEDRRSLLHLSSRLNGALRQEQNFADRFLPDEEAALA
LSKTCWEALVSPLVQNITSPDEDSTSSLGWLLNQYLECREAAYNPQSRAAAFSSRVRHLT
HLLVHVEPCEAAPPVVAISQSKGRNRSHDWSSLTTRGLPSSIMRNLTRCWRSVVEEQVNK
FLTSSWKDDDFVPRYCERYYILQKSSSELFGPRAAFLLAMRNGCADALLRLPFLRAAHVS
EQFARHIDQRIQGSRMGGARGMEMLAQLQRCLESVLILSPLEIATTFEHYYQHYMADRLL
SVGSSWLEGAVLEQIGPCFPGRLPQQMLQTLNISEELQRRFHVYQLQQLDQELLKLEDTE
KKIQVAHEDSGKEHKSKKEDAAGETAAVAMADEEEEEGKKEEGEEEEGEGEEELEEEEER
YYEGTMPEVCVLVLSPRFWPVASVCHMLNPTTCLPSYLRGTINHYSNFYSKSQSHSGLEK
ESPRQLQWTWQGRAEVQFGDQILHVSTVQMWLLLHLNHLKAVSVESLQALSELPPEVLNK
AIGPLTSSRGPLDLQEQKNIPGGVLKIRDDSEEPRPRRGNVWLIPPQTYLKAEDEEGRNL
EKRRNLLNCLVVRILKAHGDEGLHIDQLVHLVLEAWEKGPCPPRGLVSSLGRGAACRSSD
VLSCILHLLGKGTLRRHDDRPQMLFYAVPITVMEPHTESLNPGSSGPNPPLTFHTLQIRS
RGVPYASCTGTQTFSTFR
NT seq 5097 nt NT seq  +upstreamnt  +downstreamnt
atggtgggggagctccgctacagggaattcagggtgcccctggggcctggcttgcacgca
tatccggatgaattgatccgccaacgggttggccataacgggcaccctgagtatcagatc
cgctggctcatcctcaggcgcggagatgatggggactctagtcaagtggactgcaaggct
gagcatatcctgctatggatgactgacgatgagatctatgccaactgccacaagatgctg
ggggaggatggccaagtcatcagaccttcccaggagtctgcagaggctggggccctcgat
aaatctgtgctgggggagatggaaacggatgtgaagtccttgattcagagggcccttcgg
cagctggaggagtgtgtgggcgctgttcctcctgccccactccttcacacggtccatgta
ctcagtgcctatgccagcattgaacccctcacgggcgtcttcaaagatcgcagagttctg
gacttggtcatgcacatgttgagcagtcctgattatcagatccgctggagcgcaggccgg
atgatacaagctctgtcctcccatgatgctggaacccggacccagatccttctgtcactg
agccaacaagaggccatcgaaaagcacctggattttgacagccgctgcgctctgcttgca
ctgtttgcccaggctactctcacagaacacccgatgtccttcgagggcgttcagctgcca
caggtcccaggacggctgctcttctccctggtgaaacgctacctatgtgtcaccttcctc
ctggatcggctgaacggcaacgcagaggatcaagatgcccagaacaacttcattccagag
gagttgaatgctgggaggggccgggtggaactggaattcagtatggccatgggcactctg
atctccgagctggtgcaagccatgcgctgggactgggcctcaagcagatcagagagctcc
tctcccattttccagcctccgccaacagagttcttccgcccccgtgcccagcgtttcagg
aggtcaaggcggtttcgcccgcgcaccgcatttgcgagtgtcaacacctatgccttgtat
gtgcgggatacgctacggcccgggatgcgggtacggatgctggaggatttcgaggagatc
agtgctggggacgaaggccagttccgacagagcaacgacggcatgcctccggtccaggtg
ttgtgggattcgacaggccatacctactgggtacactggcacatgcttgagatcttgggc
tttgaggaagacattgaggatgtggttgacattgatgaccagggggcaatggtccatgga
ggactgggtgtagccccgccattccagcactggaagcccatagctcagctctttgccgag
ccttacgtggtgcccgaggaggaagacagggaagagagagagcacttgacccaggccgag
tggtgggagctcttcttcttcatcaagaagttaaacgcagaggaacggcagcacgtggtg
gagctccttcaggagttcctggagggggagcatgttctggactttgagatcctgcccgag
ctgactgtacctgttgagttggctcaggacctgatgctgtctctgcctcaacaacttgat
gacagcgctttgagggacctgttcaactgctatgtgtaccggaagtacggccccgaagtc
ctggtagggaagcgaaaccgcccgtttgtgctagatgaccagcttaacctattccggatc
gaaacggactctgaagatgaggctggcgctgaagcccaagatcccccatctcagagtgcc
agccctgccctgcggcaactggtggagggcttgggcccatctgggaagctccttgtggac
ctggagcgagccctcagctctgaggctccccaggaaaatgaggtcaagccatgcctgctg
cagctgcaggaggagccccagcccttcctcacactcatgcggagtctggacactccagcc
agcaacaaggccctgcacctgactgcgctgagaatcttgatgcagctggtgaacttccct
gaggcactgctgcttccctggcatgaagccatggatgcctgtatgacctgccttcggtcc
cccaatactgaccgagaggtgctccaggaactaatctttttcctacaccgcctgacctcc
acgagccgggactatgcggtgatcctaaaccagctaggagcccgggacgccatctccaag
gtcctggaaaagcaccgagggaaactggagttggctcaggagctgcgggacatggtgttc
aagtgtgagaagcatgctcacctctaccggaaactcaccacaaatattctgggcggttgc
atccagatggtgctgggccagattgaagaccacagacgaacccaccggcccatccaaatc
ccgttctttgatgtgtttctcagatatctgtgccagggctccagtgcggaagtgaagaaa
aataagtactgggagaaggtagaggtgtcctccaacccacaccgggccagcaggctgacg
gaccgcaacgccaagacctactgggagtcaaatggcactgccggctcccacttcatcacc
gtgcacatgcgcccgggtgtcctcatcaggcagctaactctactggtggctggtgaggac
tcaagctacatgccagcctgggtggtggtgtgtgggggcgacagcatcagctctgttaat
acagaactcaatgcggtgaacgtgatgccgcatgctagccgagtaatccttctggagaat
ttaacccgattctggcccatcgtccagatccgaataaagcgctgtcagcagggcggcatt
aacactcgcatccggggcctggaggtcctgggcccgaagcccaccttctggccagtgttc
cgagagcagctgtgccggcacacacgcctcttctacatggttcgtgcacaagcgtggagc
caggacatagctgaggatcgccggagcctgctacacctaagttctagactgaacggggct
ctgcggcaggagcagaattttgcagatcgcttcctccctgatgaggaggccgcactagca
ctgagcaagacctgctgggaggcgctggtcagccccctggtgcagaacatcacctcgccc
gatgaggacagcaccagttccttaggctggctgctgaatcagtacctggagtgcagggag
gctgcctacaatccccagagccgggccgcagctttctcctcccgggttcgccacctcacc
cacctcctggtccacgtggagccctgtgaggcggcacctccggtggtggccatttcccaa
tccaagggcagaaatagaagtcatgactggagctccttgaccacccgcggccttccgagc
agcatcatgaggaacttgacccgctgctggcggtctgtggtggaggagcaggtgaacaag
tttctcacctcatcctggaaagacgacgatttcgtaccccgctactgcgagcgttactac
atcctgcagaagtcgagctctgagctgttcgggccccgggccgcctttttgctagcgatg
cggaatggctgtgctgatgccttgctgaggctccctttcctcagggctgcccatgtgagt
gagcagtttgctcggcacattgaccagaggatccaaggcagccggatgggcggagcccgg
ggaatggagatgctggcacagttgcagcgatgcctggagtctgtcctgattttatctccc
ctggagatagccaccacctttgagcattactaccaacactacatggctgaccgtctcctg
agcgtaggctccagctggctggagggggccgtgctggagcagatcggtccctgtttcccc
ggccgcctcccccagcagatgctgcagaccctgaacatctcagaggagctgcagcgtcgg
ttccacgtttaccagctccagcagctcgaccaggagctcctgaagctggaagacacagaa
aagaagatccaggtggcccatgaggacagtggcaaggaacacaagagcaagaaggaagac
gctgccggagagacagcagctgtggccatggcagacgaggaggaggaagaagggaagaaa
gaggagggagaggaggaggaaggggagggagaggaggagctagaggaggaggaagagcgc
tattatgaagggacaatgccagaagtgtgtgtgcttgtcctgtctccacgtttctggcct
gttgcctccgtgtgccatatgctcaatcctacgacatgcctgccctcgtacctgaggggg
accatcaaccactactccaacttctacagcaagagtcagagccactctggcttagagaag
gagtcacccaggcaactgcagtggacgtggcagggccgggcagaagtgcagtttggcgat
cagattctacatgtgtccacagtacagatgtggctgctgctgcatctcaaccatctaaag
gcggtgtctgttgagagcctgcaggctctctcagagctccctccggaagtgcttaacaag
gcaatcgggcctctcacctcatctcgaggccccttagaccttcaggagcagaagaacata
ccaggaggggtgctcaagattcgagatgatagtgaggaacccaggccgaggaggggcaac
gtgtggctaatcccacctcagacatacctgaaggctgaggatgaggagggccggaatctg
gagaagagaaggaaccttctaaactgccttgttgtccgaatcctcaaggctcatggggat
gaaggcttgcacattgatcagctcgtccatctggtgctagaagcttgggagaaggggcca
tgtcctcctcggggtctggtcagcagccttggcaggggagcagcgtgcaggagctctgac
gtcctctcctgtatcctgcacctcctgggcaagggcacgctgagacgccatgacgaccgg
ccacagatgctgttctatgcagtccctataactgtgatggagccccacacggagtccctg
aaccctggctcgtcaggccccaatccacccctcaccttccacaccctgcagattcgatcc
cggggtgtgccttatgcttcttgcactggcacccagaccttctccactttccggtag

DBGET integrated database retrieval system