KEGG   Rattus norvegicus (rat): 108349010Help
Entry
108349010         CDS       T01003                                 

Definition
(RefSeq) protein kish-B
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1242 LST1
Motif
Other DBs
NCBI-GeneID: 108349010
NCBI-ProteinID: XP_017443492
RGD: 11454336
Ensembl: ENSRNOG00000000376
UniProt: D3ZSX4
Position
20p11
AA seq 74 aa AA seqDB search
MTNVYSLDGILVFGLLFVCTCAYFKKVPRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVA
IACIVMAFYVLFIK
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgtgtactccttggatgggattctggtgtttggtctgctctttgtttgcacc
tgtgcctacttcaagaaagtacctcgtctcaaaacctggctgctttcagagaagaaggga
gtttggggtgtattttacaaagctgctgtgattggaacccggctgcatgctgctgttgca
attgcctgcatcgtaatggccttttacgtcctgtttatcaaatga

DBGET integrated database retrieval system