KEGG   Rattus norvegicus (rat): 108349682Help
Entry
108349682         CDS       T01003                                 

Definition
(RefSeq) 60S ribosomal protein L35a
  KO
K02917  large subunit ribosomal protein L35Ae
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Module
rno_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    108349682
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    108349682
Ribosome [BR:rno03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    108349682
  Archaea
    108349682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L35Ae RimM DUF2080
Motif
Other DBs
NCBI-GeneID: 108349682
NCBI-ProteinID: XP_017445766
RGD: 11401413
Ensembl: ENSRNOG00000032303
UniProt: P04646
Position
1q43
AA seq 110 aa AA seqDB search
MSGRLWCKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTP
GGKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaggctgtggtgcaaggccatttttgctggctacaagcgaggcctccggaac
caaagagagcacacggctcttcttaaaattgaaggtgtttatgcccgagatgaaactgag
ttctacttaggcaagaggtgtgcttatgtgtacaaagcaaaaaacaatacagtgactcct
ggaggcaaaccaaacaaaaccagagtgatctggggaaaagtaactcgggcccatggaaac
agtggcatggttcgtgccaaattccgaagcaaccttcctgcaaaggccattggacacaga
atccgtgtgatgctgtacccatcccggatttaa

DBGET integrated database retrieval system