KEGG   Rattus norvegicus (rat): 108351137Help
Entry
108351137         CDS       T01003                                 

Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
rno04066  HIF-1 signaling pathway
rno05010  Alzheimer disease
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00002  Glycolysis, core module involving three-carbon compounds
rno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108351137
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    108351137
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108351137
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    108351137
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    108351137
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     108351137
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    108351137
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   108351137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N
Motif
Other DBs
NCBI-GeneID: 108351137
NCBI-ProteinID: XP_017458425
RGD: 11369796
Ensembl: ENSRNOG00000030963
UniProt: P04797
Position
5q33
AA seq 333 aa AA seqDB search
MVKVGVNGFGRIGRLVTRAAFSCDKVDIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKA
ENGKLVINGKPITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIIS
APSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAIT
ATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSV
VDLTCRLEKPAKYDDIKKVVKQAAEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIA
LNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggtcggtgtgaacggatttggccgtatcggacgcctggttaccagggctgcc
ttctcttgtgacaaagtggacattgttgccatcaacgaccccttcattgacctcaactac
atggtctacatgttccagtatgactctacccacggcaagttcaacggcacagtcaaggct
gagaatgggaagctggtcatcaacgggaaacccatcaccatcttccaggagcgagatccc
gctaacatcaaatggggtgatgctggtgctgagtatgtcgtggagtctactggcgtcttc
accaccatggagaaggctggggctcacctgaagggtggggccaaaagggtcatcatctcc
gccccttccgctgatgcccccatgtttgtgatgggtgtgaaccacgagaaatatgacaac
tccctcaagattgtcagcaatgcatcctgcaccaccaactgcttagcccccctggccaag
gtcatccatgacaactttggcatcgtggaagggctcatgaccacagtccatgccatcact
gccactcagaagactgtggatggcccctctggaaagctgtggcgtgatggccgtggggca
gcccagaacatcatccctgcatccactggtgctgccaaggctgtgggcaaggtcatccca
gagctgaacgggaagctcactggcatggccttccgtgttcctacccccaatgtatccgtt
gtggatctgacatgccgcctggagaaacctgccaagtatgatgacatcaagaaggtggtg
aagcaggcggccgagggcccactaaagggcatcctgggctacactgaggaccaggttgtc
tcctgtgacttcaacagcaactcccattcttccacctttgatgctggggctggcattgct
ctcaatgacaactttgtgaagctcatttcctggtatgacaatgaatatggctacagcaac
agggtggtggacctcatggcctacatggcctccaaggagtaa

DBGET integrated database retrieval system