KEGG   Rattus norvegicus (rat): 112400
Entry
112400            CDS       T01003                                 

Gene name
Nrg1
Definition
(RefSeq) neuregulin 1
  KO
K05455  neuregulin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112400 (Nrg1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112400 (Nrg1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    112400 (Nrg1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    112400 (Nrg1)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   112400 (Nrg1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   112400 (Nrg1)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 V-set EGF EGF_2 Ig_4 BiPBP_C Ig_6 hEGF Ig_5
Other DBs
NCBI-GeneID: 112400
NCBI-ProteinID: NP_001258052
RGD: 621341
Ensembl: ENSRNOG00000010392
UniProt: P43322
Position
16q12.3
AA seq 241 aa
MSERKEGRGKGKGKKKDRGSRGKPGPAEGDPSPALPPRLKEMKSQESAAGSKLVLRCETS
SEYSSLRFKWFKNGNELNRKNKPENIKIQKKPGKSELRINKASLADSGEYMCKVISKLGN
DSASANITIVESNEFITGMPASTETAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHLI
KCAEKEKTFCVNGGECFTVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYSTSTPFLSLP
E
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtctgagcgcaaagaaggcagaggcaaggggaagggcaagaagaaggaccggggatcc
cgcgggaagcccgggcccgccgagggcgacccgagcccagcactgcctcccagattgaaa
gaaatgaagagccaggagtcagctgcaggctccaagctagtgctccggtgcgaaaccagc
tccgagtactcctcactcagattcaaatggttcaagaatgggaacgagctgaaccgcaaa
aataaaccagaaaacatcaagatacagaagaagccagggaagtcagagcttcgaattaac
aaagcatccctggctgactctggagagtatatgtgcaaagtgatcagcaagttaggaaat
gacagtgcctctgccaacatcaccattgttgagtcaaacgagttcatcactggcatgcca
gcctcgactgagacagcctatgtgtcctcagagtctcccattagaatctcagtttcaaca
gaaggcgcaaacacttcttcatccacatcgacatccacgactgggaccagccatctcata
aagtgcgcggagaaggagaaaactttctgtgtgaatgggggcgagtgcttcacggtgaag
gacctgtcaaacccgtcaagatacttgtgcaagtgcccaaatgagtttactggtgatcgt
tgccaaaactacgtaatggccagcttctacagtacgtccactccctttctgtctctgcct
gagtag

DBGET integrated database retrieval system