KEGG   Rattus norvegicus (rat): 113892Help
Entry
113892            CDS       T01003                                 

Gene name
Nat8f3
Definition
(RefSeq) N-acetyltransferase 8 (GCN5-related) family member 3
  KO
K20838  N-acetyltransferase 8 [EC:2.3.1.80 2.3.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    113892 (Nat8f3)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.80  cysteine-S-conjugate N-acetyltransferase
     113892 (Nat8f3)
    2.3.1.-  
     113892 (Nat8f3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_4 Acetyltransf_CG Acetyltransf_9 FR47 Acetyltransf_3
Motif
Other DBs
NCBI-GeneID: 113892
NCBI-ProteinID: XP_006225036
RGD: 621607
Ensembl: ENSRNOG00000015763
UniProt: Q9QXS4
Position
4q34
AA seq 228 aa AA seqDB search
MAPYHIRKYQDSDHRSVVNLFCRGTEEHISASFRYMLLLPGTLLILLGVPLTLFLASGSW
LLVLLSTLTLLVSLWLLAKYPWEKYTAMCLHSDMADIPRTYLSSHYSCFWVAESRGQMVG
IIAVLPVKDPLLQRKQLQLRHLSVSLEHRREGIGRAMVRTALQFAEMQGFSEVVLVTSML
QYAALALYQSMGFQKTGEFFYTFVSRLRNSPMICLKYCLTSALNDLKT
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggctccttatcatatccgaaaataccaggacagcgaccacaggagtgtagtgaatttg
ttctgcagaggcacggaggagcacatctccgccagcttccgctacatgctgctgctgccc
ggaaccctcctgatcttactcggggtccctcttactctattcttggcctcaggctcctgg
cttctggttcttctgtccacccttaccctccttgtttccctgtggctccttgcaaaatac
ccttgggagaagtatacggcaatgtgtttgcactcagacatggctgatatccccagaacc
tacttgagttctcattactcctgcttctgggtggctgagtctagaggtcagatggtgggc
ataatcgctgttttaccagtgaaggatcccctcctgcagaggaagcaactgcagctacgt
cacctctctgtgtccctggagcaccggagagaggggattggaagagctatggtcaggact
gccctccagtttgcagagatgcagggcttcagtgaagttgtcctggtcaccagcatgttg
cagtatgctgccctagctctgtaccagagcatgggcttccagaagactggtgagttcttc
tatacctttgtctctcgactaaggaattctccaatgatatgcttaaaatattgcctcact
tctgctctgaatgacctgaaaacctga

DBGET integrated database retrieval system