KEGG   Rattus norvegicus (rat): 113893Help
Entry
113893            CDS       T01003                                 

Gene name
Sncb
Definition
(RefSeq) synuclein, beta
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Synuclein
Motif
Other DBs
NCBI-GeneID: 113893
NCBI-ProteinID: NP_542955
RGD: 70992
Ensembl: ENSRNOG00000018039
UniProt: Q63754 A0A0G2JSQ1
Position
17p14
AA seq 134 aa AA seqDB search
MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTKEGVVQGVASVAEKTK
EQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYE
DSPQEEYQEYEPEA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgttcatgaagggcctgtccatggccaaggagggcgttgtggctgcagctgag
aaaaccaagcagggggtcaccgaggcggcagagaagaccaaggaaggcgtcctctacgtc
ggaagcaagaccaaagagggagtggtacaaggcgtggcctcagtggctgagaaaaccaag
gagcaggcatctcatctgggaggagctgtgttctctggggctgggaacattgcagcagcc
accggcctggtgaagaaggaggagttccccacagacctgaagccagaggaagtggcccaa
gaagcggctgaggagcccctgattgagcctctgatggagcctgaaggggaaagttacgag
gactcaccccaggaggaatatcaggaatacgagccagaggcgtaa

DBGET integrated database retrieval system