KEGG   Rattus norvegicus (rat): 113894
Entry
113894            CDS       T01003                                 

Gene name
Sqstm1
Definition
(RefSeq) sequestosome-1 isoform 1
  KO
K14381  sequestosome 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04217  Necroptosis
rno04218  Cellular senescence
rno04380  Osteoclast differentiation
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113894 (Sqstm1)
   04137 Mitophagy - animal
    113894 (Sqstm1)
  09143 Cell growth and death
   04217 Necroptosis
    113894 (Sqstm1)
   04218 Cellular senescence
    113894 (Sqstm1)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113894 (Sqstm1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    113894 (Sqstm1)
   05022 Pathways of neurodegeneration - multiple diseases
    113894 (Sqstm1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113894 (Sqstm1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    113894 (Sqstm1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    113894 (Sqstm1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    113894 (Sqstm1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Mitophagy
   Cargo receptors
    113894 (Sqstm1)
  Pexophagy
    113894 (Sqstm1)
  Aggrephagy
    113894 (Sqstm1)
  Xenophagy
    113894 (Sqstm1)
  Other autophagy associated proteins
   Midbophagy associated proteins
    113894 (Sqstm1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    113894 (Sqstm1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113894 (Sqstm1)
SSDB
Motif
Pfam: UBA_5 PB1 ZZ C1_2
Other DBs
NCBI-GeneID: 113894
NCBI-ProteinID: NP_787037
RGD: 69287
Ensembl: ENSRNOG00000003147
UniProt: O08623
Structure
PDB: 
2KTR 2KKC

Position
10
AA seq 439 aa
MASLTVKAYLLGKEEAAREIRRFSFCFSPEPEAEAAAGPGPCERLLSRVAVLFPALRPGG
FQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRREHRPPCAQEARSMVH
PNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHREHSKLIFPNPFGHLSDSFSHSR
WLRKLKHGHFGWPGWEMGPPGNWSPRPPRAGDGRPCPTAESASAPSEDPNVNFLKNVGES
VAAALSPLGIEVDIDVEHGGKRSRLTPTSAESSSTGTEDKSGTQPSSCSSEVSKPDGAGE
GPAQSLTEQMKKIALESVGQPEELMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPES
EGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKN
YDIGAALDTIQYSKHPPPL
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggcttcgctcacggtgaaggcctatctactgggcaaggaggaggcggcccgcgagatc
cgccgcttcagcttctgcttcagcccggagccggaggcggaagccgcggctggcccgggg
ccctgcgagaggctgctgagccgggtggctgtgctgttccccgcgctgcggcctggaggc
tttcaggcgcactaccgcgatgaggatggggacttggtcgccttctccagtgatgaggaa
ctgacaatggccatgtcctatgtgaaagatgacatcttccgcatctacattaaagagaag
aaggagtgccggcgggaacatcgccccccatgtgctcaggaggcacgaagcatggtgcac
cccaacgtgatttgtgatggttgcaatgggcctgtggtgggaactcgctataagtgcagt
gtgtgccccgactacgacctgtgcagcgtctgcgaggggaagggcctgcacagggagcac
agcaagctcatctttcccaacccctttggccacctctctgatagcttctctcatagccgc
tggcttcggaagctgaaacatgggcactttggctggcctggctgggagatgggcccacca
gggaactggagcccacgtcctcctcgcgcaggggatggtcgcccttgccccacagctgag
tcggcttctgctccatcagaggatcccaatgtcaatttcctgaagaatgtgggggagagc
gtggcagctgccctcagccctctaggcatcgaggttgacattgatgtggaacatggaggg
aagagaagccgcctgacacccacctctgcagaaagttccagcacaggcacagaagataag
agtggtactcagccaagcagctgctcttcggaagtcagcaaacctgacggggccggggag
ggccctgctcagtctctgacagagcagatgaagaagatagccttggagtcggtgggacag
ccagaggaactgatggagtcggataactgctcaggaggggatgacgactggacgcatttg
tcttctaaagaagtggacccatccacaggtgaactccagtctctacagatgccagaatcg
gaagggccaagctctctagacccctcacaggaaggccccacagggctgaaggaagctgcc
ctgtacccacatctcccaccagaggctgatccccggctgattgagtcactctctcagatg
ctgtccatgggtttctcggatgaaggcggctggctcaccaggctcctacagaccaagaat
tatgacatcggggctgctctggacacgatccagtattcaaagcaccctccaccattgtga

DBGET integrated database retrieval system