KEGG   Rattus norvegicus (rat): 113898
Entry
113898            CDS       T01003                                 
Symbol
Prdx5
Name
(RefSeq) peroxiredoxin-5, mitochondrial precursor
  KO
K11187  peroxiredoxin 5 [EC:1.11.1.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    113898 (Prdx5)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     113898 (Prdx5)
SSDB
Motif
Pfam: Redoxin AhpC-TSA
Other DBs
NCBI-GeneID: 113898
NCBI-ProteinID: NP_446062
RGD: 71007
Ensembl: ENSRNOG00000021125
UniProt: Q9R063
Position
1:complement(204099826..204103589)
AA seq 213 aa
MVQLRFCVLGSIAGSVLRASATWTCVAGRAGRKGAGWECGGARSFSSAAVTMAPIKVGDT
IPSVEVFEGEPGKKVNLAELFKDKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQ
VVACLSVNDAFVTAEWGRAHQAEGKVQLLADPTGAFGKETDLLLDDSLVSLFGNRRLKRF
SMVIDKGVVKALNVEPDGTGLTCSLAPNILSQL
NT seq 642 nt   +upstreamnt  +downstreamnt
atggtccagctgaggttttgcgtcctaggcagcatagccggatcggtgctccgtgcatcg
gctacttggacgtgcgtggcaggcagagcaggccggaaaggagcaggttgggagtgtggt
ggggcccgcagcttcagcagtgccgcggtgactatggccccgatcaaggtgggagacacc
attccctcagtggaggtatttgaaggggaacctggaaagaaggtgaacttggcagagctg
ttcaaggacaagaaaggtgttttgtttggagtccctggggcatttacacctggctgttcc
aagacccatctgcctgggtttgtggagcaagccggagctctgaaggccaagggagcacaa
gtggtggcctgtctgagtgttaatgatgccttcgtgactgcagagtggggtcgagcccac
caggcagaaggcaaggttcagctcctggctgaccccactggagcttttggaaaggagaca
gatttactactagatgattctttggtgtctctctttgggaatcgtcggctaaaaaggttc
tccatggtgatagacaagggcgtagtaaaggcactgaacgtggagccggatggcacaggc
ctcacctgcagcctggcccccaacatcctctcacaactctga

DBGET integrated database retrieval system