KEGG   Rattus norvegicus (rat): 113912
Entry
113912            CDS       T01003                                 

Gene name
Rtn4r, NgR, NgR1, Nogor
Definition
(RefSeq) reticulon 4 receptor
  KO
K16659  reticulon-4 receptor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    113912 (Rtn4r)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Receptors
  113912 (Rtn4r)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9
Other DBs
NCBI-GeneID: 113912
NCBI-ProteinID: NP_446065
RGD: 620810
Ensembl: ENSRNOG00000030920
UniProt: Q99M75
Structure
PDB: 
3KJ4

Position
11q23
AA seq 473 aa
MKRASSGGSRLPTWVLWLQAWRVATPCPGACVCYNEPKVTTSRPQQGLQAVPAGIPASSQ
RIFLHGNRISYVPAASFQSCRNLTILWLHSNALAGIDAAAFTGLTLLEQLDLSDNAQLRV
VDPTTFRGLGHLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNL
THLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSM
LPAEVLVPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSGVPSNLPQRLAGRDLKR
LATSDLEGCAVASGPFRPFQTNQLTDEELLGLPKCCQPDAADKASVLEPGRPASVGNALK
GRVPPGDTPPGNGSGPRHINDSPFGTLPGSAEPPLTALRPGGSEPPGLPTTGPRRRPGCS
RKNRTRSHCRLGQAGSGSSGTGDAEGSGALPALACSLAPLGLALVLWTVLGPC
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaagagggcgtcctccggaggaagccggctgccgacatgggtgttatggctacaggcc
tggagggtagcaacgccctgccctggtgcctgtgtgtgctacaatgagcccaaggtcaca
acaagccgcccccagcagggcctgcaggctgtacccgctggcatcccagcctccagccag
agaatcttcctgcacggcaaccgaatctcttacgtgccagccgccagcttccagtcatgc
cggaatctcaccatcctgtggctgcactcaaatgcgctggccgggattgatgccgcggcc
ttcactggtctgaccctcctggagcaactagatcttagtgacaatgcacagctccgtgtc
gtggaccccaccacgttccgtggcctgggccacctgcacacgctgcacctagaccgatgc
ggcctgcaggagctggggcctggcctattccgtgggctggcagctctgcagtacctctac
ctacaagacaacaacctgcaggcacttcccgacaacaccttccgagacctgggcaacctc
acgcatctctttctgcatggcaaccgtatccccagtgttcctgagcacgctttccgtggc
ttgcacagtcttgaccgtctcctcttgcaccagaaccatgtggctcgtgtgcacccacat
gccttccgggaccttggccgactcatgaccctctacctgtttgccaacaacctctccatg
ctccccgcagaggtcctagtgcccctgaggtctctgcagtacctgcgactcaatgacaac
ccctgggtgtgtgactgcagggcacgtccgctctgggcctggctgcagaagttccgaggt
tcctcatccggggtgcccagcaacctaccccaacgcctggcaggccgtgatctgaagcgc
ctggctaccagtgacttagagggttgtgctgtggcttcggggcccttccgtcccttccag
accaatcagctcactgatgaggagctgctgggcctccccaagtgctgccagccggatgct
gcagacaaggcctcagtactggaacccgggaggccggcgtctgttggaaatgcactcaag
ggacgtgtgcctcccggtgacactccaccaggcaatggctcaggcccacggcacatcaat
gactctccatttgggactttgcccggctctgcagagcccccactgactgccctgcggcct
gggggttccgagcccccgggactgcccaccacgggcccccgcaggaggccaggttgttcc
agaaagaaccgcacccgtagccactgccgtctgggccaggcaggaagtgggagcagtgga
actggggatgcagaaggttcgggggccctgcctgccctggcctgcagccttgctcctctg
ggccttgcactggtactttggacagtgcttgggccctgctga

DBGET integrated database retrieval system