KEGG   Rattus norvegicus (rat): 113914Help
Entry
113914            CDS       T01003                                 

Gene name
Taar1, Tar1, Trar1, taR-1
Definition
(RefSeq) trace-amine-associated receptor 1
  KO
K05051  trace amine associated receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113914 (Taar1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    113914 (Taar1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 113914
NCBI-ProteinID: NP_599155
RGD: 621621
Ensembl: ENSRNOG00000016073
UniProt: Q923Y9 A0A0G2JSP2
Position
1p12
AA seq 332 aa AA seqDB search
MHLCHNSANISHTNSNWSRDVRASLYSLISLIILTTLVGNLIVIISISHFKQLHTPTNWL
LHSMAVVDFLLGCLVMPYSMVRTVEHCWYFGELFCKLHTSTDIMLSSASILHLAFISIDR
YYAVCDPLRYKAKINLAAIFVMILISWSLPAVFAFGMIFLELNLEGVEEQYHNQVFCLRG
CFPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRANLQVGLEGESRAPQ
SKETKAAKTLGIMVGVFLLCWCPFFFCMVLDPFLGYVIPPTLNDTLNWFGYLNSAFNPMV
YAFFYPWFRRALKMVLFGKIFQKDSSRSKLFL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcatctttgccacaatagcgcgaatatttcccacacgaacagcaactggtcaagggat
gtccgtgcttcactgtacagcttaatatcactcataattctaaccactctggttggcaac
ttaatagtaatcatttcgatatcccacttcaagcaacttcacacgcccacaaattggctc
cttcattccatggccgttgtcgactttctgctgggctgtctggtcatgccctacagcatg
gtgagaacagttgagcactgctggtactttggggaactcttctgcaaacttcacaccagc
actgatatcatgctgagctcggcatccattctccacctagccttcatttccattgaccgc
tactatgctgtgtgcgaccctttaagatacaaagccaagatcaatctcgccgccattttt
gtgatgatcctcattagctggagccttcctgctgtttttgcatttgggatgatcttcctg
gagctgaacttagaaggagttgaggagcagtatcacaatcaggtcttctgcctgcgcggc
tgttttcccttcttcagtaaagtatctggggtactggcattcatgacgtctttctatata
cctggatctgttatgttatttgtttactatagaatatatttcatagctaaaggacaagcg
aggtcaattaatcgtgcaaatcttcaagttggattggaaggggaaagcagagcgccacaa
agcaaggaaacaaaagccgcaaaaaccttagggatcatggtgggcgttttcctcctgtgc
tggtgcccgttctttttctgcatggtcctggaccctttcctgggctatgttatcccaccc
actctgaatgacacactgaattggttcgggtacctgaactctgccttcaacccgatggtt
tatgcctttttctatccctggttcagaagagcgttgaagatggttctcttcggtaaaatt
ttccaaaaagattcatctaggtctaagttatttttgtaa

DBGET integrated database retrieval system