KEGG   Rattus norvegicus (rat): 113918
Entry
113918            CDS       T01003                                 

Symbol
Slc6a20
Name
(RefSeq) sodium- and chloride-dependent transporter XTRP3
  KO
K05048  solute carrier family 6 (neurotransmitter transporter, amino acid/orphan) member 15/16/17/18/20
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    113918 (Slc6a20)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   113918 (Slc6a20)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 113918
NCBI-ProteinID: NP_579830
RGD: 621651
Ensembl: ENSRNOG00000006010
UniProt: Q64093
Position
8
AA seq 616 aa
MRLAIKRRASRGQRPGPDEKRARDMEKARPQWGNPLQFVFACISYAVGLGNVWRFPYLCQ
MYGGGSFLVPYLIMLIVEGMPLLYLELAVGQRMRQGSIGAWRTISPYLSGVGVASVVVSF
FLSMYYNVINAWGFWYLFHSFQDPLPWSVCPLNSNRTGYDEECEKASSTQYFWYRKTLNI
SPSIQENGGVQWEPALCLTLAWLMVYLCILRGTESTGKVVYFTALMPYCVLIIYLVRGLT
LHGATNGLMYMFTPKIEQLANPKAWINAATQIFFSLGLGFGSLIAFASYNEPSNDCQKHA
VIVSVINSSTSIFASIVTFSIYGFKATFNYENCLNKVILLLTNSFDLEDGFLTASNLEEV
KDYLASTYPNKYSEVFPHIRNCSLESELNTAVQGTGLAFIVYAEAIKNMEVSQLWSVLYF
FMLLMLGMGSMLGNTAAILTPLTDSKVISSYLPKEAISGLVCLINCAVGMVFTMEAGNYW
FDIFNDYAATLSLLLIVLVETIAVCYVYGLRRFESDLRAMTGRPLNWYWKAMWAFVSPLL
IIGLFIFYLSDYILTGTLQYQAWDATQGQLVTKDYPPHALAVIGLLVASSTMCIPLVALG
TFIRNRLKRGGSSPVA
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgagattagcaattaaaaggcgggcgagccgcggccagagaccaggccctgacgagaag
cgagcgcgggacatggagaaggcacggcctcaatggggcaatccgctgcagttcgttttc
gcctgtatctcctacgccgtgggtttgggcaatgtgtggcgcttcccctacctgtgccag
atgtacggcggagggagtttcctggtcccctacctcatcatgctcattgtggaggggatg
ccactcttgtacctggagctggctgtggggcagcgcatgcggcagggcagcattggtgcc
tggaggaccatcagcccctaccttagtggtgtcggtgttgccagtgtggtggtctccttc
ttcctctccatgtactacaatgtcatcaatgcctggggcttctggtacctcttccactcc
ttccaggatcccctgccgtggtctgtctgcccactgaatagtaaccgcacaggctatgat
gaggagtgtgagaaggcttcgtcgacacagtacttctggtacaggaaaacactcaacatc
tcaccgtccatccaggagaatggaggagtgcagtgggagccagccctgtgcctcaccctg
gcctggctgatggtatatctgtgcatcctgagaggcaccgaatctactggcaaggtggtc
tacttcaccgcattgatgccttactgtgttcttattatctacttggtccgtggcctcaca
ctccatggagccaccaatggcctgatgtacatgttcacacctaagattgagcagctagcc
aaccccaaggcctggatcaatgcagccacgcagatcttcttctcactgggcttgggtttt
ggcagcctgatcgcttttgccagctacaatgaaccctccaacgactgccagaagcatgct
gtcattgtgtctgtcatcaacagctccacctccatatttgccagcattgtcaccttctcc
atctatggcttcaaggccaccttcaactatgaaaactgcttaaacaaggtgattctgctg
ctgaccaattcttttgaccttgaagatggctttctgacagccagcaacctggaggaggtg
aaggactacctggcatctacttacccaaacaagtacagtgaagtgttcccacacattaga
aactgcagcttggaatcagagctgaacacggctgtccaaggcacaggcctggccttcatc
gtctacgctgaggccattaaaaacatggaagtgtcccagctctggtcagtgctctacttc
ttcatgctgctgatgctgggaatggggagcatgcttggaaatacagcggccatcctcacc
cctctgactgacagcaaggtcatctccagctacctgcccaaggaggccatttcaggtctg
gtgtgcctcattaactgtgctgttggcatggtgttcaccatggaggctgggaactactgg
tttgacatattcaatgactatgcagccacgctgtctctgctgctcattgtgctggtggag
actatagctgtgtgctacgtgtatgggctgaggagatttgaaagtgatcttcgggccatg
actggccggcccctcaactggtactggaaggccatgtgggcttttgtgagcccactgctc
atcatcggcctctttatcttctacctgagtgactacatcctcacgggaacgctgcagtac
caagcctgggatgctactcaggggcagctggtgaccaaggattaccctccacatgcacta
gctgtcatcggtttgctggtggcttcatctactatgtgcatccccctggtggccctgggg
actttcatcaggaatcgcctcaagaggggaggctcttccccagtggcctaa

DBGET integrated database retrieval system