KEGG   Rattus norvegicus (rat): 113919
Entry
113919            CDS       T01003                                 

Gene name
Gpx5
Definition
(RefSeq) epididymal secretory glutathione peroxidase precursor
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
rno04918  Thyroid hormone synthesis
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    113919 (Gpx5)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    113919 (Gpx5)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    113919 (Gpx5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    113919 (Gpx5)
   05016 Huntington disease
    113919 (Gpx5)
   05022 Pathways of neurodegeneration - multiple diseases
    113919 (Gpx5)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     113919 (Gpx5)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 113919
NCBI-ProteinID: NP_001099208
RGD: 69227
UniProt: P30710
Position
17
AA seq 221 aa
MAIQLRVFYLVPLLLASYVQTTPRLEKMKMDCYKDVKGTIYNYEALSLNGKERIPFKQYA
GKHVLFVNVATYCGLTIQYPELNALQDDLKQFGLVILGFPCNQFGKQEPGDNTEILPGLK
YVRPGKGFLPNFQLFAKGDVNGEKEQEIFTFLKRSCPHPSETVVTSKHTFWEPIKVHDIR
WNFEKFLVGPNGVPVMRWFHQAPVSTVKSDILAYLNQFKTI
NT seq 666 nt   +upstreamnt  +downstreamnt
atggctatacagctaagagtcttctatctcgttccacttcttctagccagctatgtgcag
acaacccccaggctggaaaagatgaagatggactgctacaaagatgtgaaaggcaccatc
tacaactacgaggctctgtctcttaatgggaaggaacgcattccattcaagcagtatgca
ggaaagcacgtcctctttgtcaatgtggctacctattgtggtctgacaattcagtatcct
gaactgaatgcactccaggatgatctgaagcaatttggcttggttatattgggctttccc
tgcaaccaatttggaaagcaagaaccaggagacaatacagagattcttcctgggctcaag
tatgttcgtccgggaaaaggatttttacctaatttccagctttttgcgaaaggggatgta
aatggtgaaaaagagcaggaaatctttaccttcttgaagcgctcctgtcctcacccctca
gagactgtggtcacaagcaaacatacattctgggagccaataaaagtccatgacatccgc
tggaactttgagaagtttctggtgggacccaacggtgtccctgtcatgcgctggttccac
caggctcctgtcagcactgtcaagtctgacatcctggcgtacctgaatcaattcaaaacc
atatag

KEGG   Rattus norvegicus (rat): 24404
Entry
24404             CDS       T01003                                 

Gene name
Gpx1
Definition
(RefSeq) glutathione peroxidase 1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
rno04918  Thyroid hormone synthesis
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    24404 (Gpx1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    24404 (Gpx1)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    24404 (Gpx1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    24404 (Gpx1)
   05016 Huntington disease
    24404 (Gpx1)
   05022 Pathways of neurodegeneration - multiple diseases
    24404 (Gpx1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     24404 (Gpx1)
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 24404
NCBI-ProteinID: NP_110453
RGD: 2729
UniProt: P04041
Position
8
AA seq 201 aa
MSAARLSAVAQSTVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTTRDYTEMNDL
QKRLGPRGLVVLGFPCNQFGHQENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKA
HPLFTFLRNALPAPSDDPTALMTDPKYIIWSPVCRNDISWNFEKFLVGPDGVPVRRYSRR
FRTIDIEPDIEALLSKQPSNP
NT seq 606 nt   +upstreamnt  +downstreamnt
atgtctgctgctcggctctccgcggtggcacagtccaccgtgtatgccttctccgcgcgc
ccgctggcgggcggggagcccgtgagcctgggctccctgcggggcaaggtgctgctcatt
gagaatgtcgcgtccctctgaggcaccacgacccgggactacaccgaaatgaatgatctg
cagaagcgtctggggcctcgtggcctggtggtgctcggtttcccgtgcaatcagttcgga
catcaggagaatggcaagaatgaagagattctgaattccctcaagtatgtccgacccggt
ggtgggttcgagcccaactttacattgtttgagaagtgcgaggtgaatggtgagaaggct
cacccgctctttaccttcctgcggaatgccttgccagcacccagtgacgatcccactgcg
ctcatgaccgaccccaagtacatcatttggtccccggtgtgccgcaacgacatttcctgg
aactttgagaagttcctggtaggtccagacggtgttccagtgcgcagatacagcaggcgc
tttcgcaccatcgacatcgaacccgatatagaagccctgctgtccaagcagcctagcaac
ccctaa

KEGG   Rattus norvegicus (rat): 259233
Entry
259233            CDS       T01003                                 

Gene name
Gpx6
Definition
(RefSeq) glutathione peroxidase 6 precursor
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
rno04918  Thyroid hormone synthesis
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    259233 (Gpx6)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    259233 (Gpx6)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    259233 (Gpx6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    259233 (Gpx6)
   05016 Huntington disease
    259233 (Gpx6)
   05022 Pathways of neurodegeneration - multiple diseases
    259233 (Gpx6)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     259233 (Gpx6)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 259233
NCBI-ProteinID: NP_671694
RGD: 628789
Ensembl: ENSRNOG00000060749
UniProt: Q64625
Position
17
AA seq 221 aa
MTQQFWGPCLFSLFMAVLAQETLDPQKSKVDCNKGVAGTVYEYGANTLDGGEYVQFQQYA
GKHILFVNVASFCGLTATYPELNTLQEELRPFNVSVLGFPCNQFGKQEPGKNSEILLGLK
YVRPGGGFVPNFQLFEKGDVNGDNEQKVFSFLKSSCPPTSELLGSPEHLFWDPMKVHDIR
WNFEKFLVGPDGAPVMRWFHQTPVRVVQSDIMEYLNQTRTQ
NT seq 666 nt   +upstreamnt  +downstreamnt
atgacccagcagttctggggtccctgtcttttctcattgtttatggctgtattggctcag
gagacactggatcctcaaaaatcaaaggtggattgcaacaaaggggtggctggcaccgtc
tatgagtacggagccaacaccttagatggtggggagtatgtccagttccagcagtatgca
ggaaagcacatcctctttgtcaacgtggcgtccttctgtggcctgacagctacgtaccct
gaactgaacacattgcaggaggagctgagaccattcaatgtcagtgttttgggctttcca
tgcaaccagtttggaaaacaagaacctggaaagaactcagagatcctccttggactcaaa
tatgttcgcccaggcggtggctttgttcccaatttccagctctttgagaagggggatgtg
aacggagacaatgaacaaaaggttttttctttcctaaagagctcctgccctcccacctct
gaacttcttggctctccagaacatctcttctgggatcccatgaaggtccatgacattcgc
tggaactttgagaagttcctggtgggaccggatggagcccctgtcatgcgctggttccac
cagactcctgtcagagttgtccagtcagacatcatggagtacctaaaccaaacccgtacc
cagtag

KEGG   Rattus norvegicus (rat): 29326
Entry
29326             CDS       T01003                                 

Gene name
Gpx2
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
rno04918  Thyroid hormone synthesis
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    29326 (Gpx2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    29326 (Gpx2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    29326 (Gpx2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    29326 (Gpx2)
   05016 Huntington disease
    29326 (Gpx2)
   05022 Pathways of neurodegeneration - multiple diseases
    29326 (Gpx2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     29326 (Gpx2)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 29326
NCBI-ProteinID: NP_899653
RGD: 727780
Position
6
AA seq 190 aa
MAYIAKSFYDLSAIGLDGEKIDFNTFRGRAVLIENVASLUGTTTRDYTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGFQPTFSLTQKCDVNGQNQHPVFAYLK
DKLPYPYDDPFSLMTDPKLIIWSPVRRSDVSWNFEKFLIGPEGEPFRRYSRTFQTINIEP
DIKRLLKVAI
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcttacatcgccaagtctttttacgatctcagtgccatcggcctggatggggagaag
atagacttcaacacgttccgaggcagggccgtgctgattgagaatgtggcctcgctctga
ggaacaactacccgggactacacccagctcaatgagttgcagtgccgctttcccaggcgc
ctagtggttctcggcttcccttgcaaccagttcggacatcaggagaactgtcagaatgag
gagatcctgaacagcctcaagtatgtccgccctgggggtgggttccagcccaccttcagt
cttacccaaaagtgtgatgtcaatgggcagaatcagcatcctgtctttgcctacctgaaa
gacaagctgccctacccttatgacgacccattctccctcatgaccgatcccaagctcatc
atatggagtccggtgcgccgctcagatgtgtcctggaactttgagaagttcctcataggg
ccagaaggggagcctttccgtcgctacagccgcaccttccagaccatcaacatcgagcct
gacatcaaacgtctcctcaaagttgccatctaa

KEGG   Rattus norvegicus (rat): 294744
Entry
294744            CDS       T01003                                 

Gene name
Gpx8
Definition
(RefSeq) probable glutathione peroxidase 8
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
rno04918  Thyroid hormone synthesis
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    294744 (Gpx8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    294744 (Gpx8)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    294744 (Gpx8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    294744 (Gpx8)
   05016 Huntington disease
    294744 (Gpx8)
   05022 Pathways of neurodegeneration - multiple diseases
    294744 (Gpx8)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     294744 (Gpx8)
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 294744
NCBI-ProteinID: NP_001099881
RGD: 1307506
Ensembl: ENSRNOG00000010461
UniProt: D3ZPW7
Position
2
AA seq 209 aa
MEPLGAYPLKCSGPKAKIFAVLLSMVLCTVMLFLLQLKFLKPRINSFYSFEVKDAKGRMV
SLEKFKGKASLVVNVASDCRFTDKSYETLRELHKEFGPYHFNVLAFPCNQFGESEPKSSK
EVESFARKNYGVTFPIFHKIKILGPEAEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKF
WRPEEPLEAIRPHVSQMIGQIILKKKEDL
NT seq 630 nt   +upstreamnt  +downstreamnt
atggagcctctcggtgcctacccactaaaatgttccgggcccaaagcaaagatatttgca
gttttgctatctatggttctgtgcaccgtgatgctttttctccttcagttaaaattcctg
aagccgagaatcaacagcttctactcctttgaagtgaaggatgccaaaggaaggatggtg
tctctggaaaagttcaaaggcaaagcttccctagttgtaaacgtggctagtgactgccgg
ttcacagacaagagttacgagaccctcagggagctgcacaaggagtttgggccctatcac
ttcaacgtcctggctttcccgtgcaatcagtttggagaatcggagcccaagtccagcaag
gaggtagaatcttttgcaagaaaaaactacggagtcacattccccatcttccacaagatt
aagattttagggccggaagcagaacctgcgtttagatttcttgttgattcttccaagaag
gaaccaaggtggaacttttggaagtatctggtcaaccctgagggacaagtcgtgaagttc
tggaggccagaagaaccccttgaagccatcagacctcatgtgtcacaaatgattgggcaa
atcattcttaaaaagaaagaggatctatga

KEGG   Rattus norvegicus (rat): 298376
Entry
298376            CDS       T01003                                 

Gene name
Gpx7
Definition
(RefSeq) glutathione peroxidase 7 precursor
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
rno04918  Thyroid hormone synthesis
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    298376 (Gpx7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    298376 (Gpx7)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    298376 (Gpx7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    298376 (Gpx7)
   05016 Huntington disease
    298376 (Gpx7)
   05022 Pathways of neurodegeneration - multiple diseases
    298376 (Gpx7)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     298376 (Gpx7)
SSDB
Motif
Pfam: GSHPx AhpC-TSA
Other DBs
NCBI-GeneID: 298376
NCBI-ProteinID: NP_001100143
RGD: 1306999
Ensembl: ENSRNOG00000009751
UniProt: D3ZQI1
Position
5
AA seq 186 aa
MVAAVATAWLLLWAAACTQSEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTD
QNYRALQQLQRDLGPYHFNVLAFPCNQFGQQEPDSNREIENFARRTYSVSFPMFSKIAVT
GTGAHPAFKYLTQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVPVEEIKPRITEQVMKLIL
QKREDL
NT seq 561 nt   +upstreamnt  +downstreamnt
atggttgcggctgtggcgacggcgtggctgctcctgtgggccgcggcctgcacgcaatcc
gagcaagacttctacgacttcaaggcggtgaacatccggggcaagctggtgtcgctggag
aagtaccgcggctcggtttccctggtggtgaatgtagctagcgaatgtggcttcacagac
cagaactaccgagccttgcagcagctgcagcgggacctgggcccctaccattttaacgtg
cttgctttcccttgcaaccagtttggccaacaggaaccagacagcaacagggagattgag
aactttgcccgccgcacctacagtgtctctttccccatgtttagcaagatcgcagtcact
ggcactggtgcccaccctgccttcaaatacctaacccaaacttctgggaaggagcccacc
tggaacttctggaagtacctagtggccccagacggaaaggtggtgggggcatgggatccc
actgtgccggtggaggagatcaagccccgtattacagagcaggtgatgaagctcatcctt
cagaaacgagaagacttgtga

KEGG   Rattus norvegicus (rat): 64317
Entry
64317             CDS       T01003                                 

Gene name
Gpx3
Definition
(RefSeq) glutathione peroxidase 3 precursor
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
rno04918  Thyroid hormone synthesis
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    64317 (Gpx3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    64317 (Gpx3)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    64317 (Gpx3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    64317 (Gpx3)
   05016 Huntington disease
    64317 (Gpx3)
   05022 Pathways of neurodegeneration - multiple diseases
    64317 (Gpx3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     64317 (Gpx3)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 64317
NCBI-ProteinID: NP_071970
RGD: 69224
Ensembl: ENSRNOG00000052564
UniProt: P23764
Position
10
AA seq 226 aa
MARILRASCLLSLLLAGFVPPGRGQEKSKTDCHGGMSGTIYEYGALTIDGEEYIPFKQYA
GKYILFVNVASYUGLTDQYLELNALQEELGPFGLVILGFPCNQFGKQEPGENSEILPSLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIR
WNFEKFLVGPDGIPIMRWYHRTTVSNVKMDILSYMRRQAALGARGK
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcccggatccttcgggcatcctgcctcctgtccctgctcctggccgggtttgttccg
ccgggccggggacaagagaagtccaagacagactgccatggcggtatgagcggtaccatc
tacgagtatggagcccttaccatcgatggggaggaatacattccttttaagcagtatgct
ggcaaatacatcctctttgtcaacgtagccagctactgaggtctgacagaccaatacctt
gaactgaatgcactacaagaagaacttggcccattcggcctggtcattctgggcttccct
tgcaaccaatttggcaaacaggagccaggcgagaactcggagatcctgcctagtctcaag
tacgttcgaccgggtgggggctttgtgcctaatttccagctctttgagaaaggagacgtg
aacggggagaaagagcagaagttctacactttcctgaagaactcctgccctcccactgcg
gaactcctgggctcacctggccgcctcttttgggaacccatgaagatccatgacatccgc
tggaactttgagaagttcctggtggggccagatggcataccaattatgcgctggtaccac
cggaccacagtcagcaacgtcaagatggacatcctgtcctatatgaggcggcaggcagcc
ctgggggccagagggaagtaa

DBGET integrated database retrieval system