KEGG   Rattus norvegicus (rat): 113927Help
Entry
113927            CDS       T01003                                 

Gene name
Csnk1a1
Definition
(RefSeq) casein kinase 1, alpha 1
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno04340  Hedgehog signaling pathway
rno05165  Human papillomavirus infection
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113927 (Csnk1a1)
   04340 Hedgehog signaling pathway
    113927 (Csnk1a1)
 09160 Human Diseases
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    113927 (Csnk1a1)
   05226 Gastric cancer
    113927 (Csnk1a1)
   05224 Breast cancer
    113927 (Csnk1a1)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    113927 (Csnk1a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    113927 (Csnk1a1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113927 (Csnk1a1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   113927 (Csnk1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Pox_ser-thr_kin Kdo ABC1
Motif
Other DBs
NCBI-GeneID: 113927
NCBI-ProteinID: NP_446067
RGD: 71098
Ensembl: ENSRNOG00000017106
UniProt: P97633
Position
18q12.1
AA seq 325 aa AA seqDB search
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQGKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGF
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaggccgaatttatcgtcggtgggaaatacaaactggtg
cggaagatcggatctggttccttcggggacatttatctagcgatcaacatcaccaatggc
gaggaagtggcagtgaaactagaatcccagaaggccaggcatccccagttgctgtacgag
agcaaactgtataagattcttcaaggtggggttggcatccctcacatacggtggtatggg
caaggaaaagactataatgtgctagtcatggatcttctgggacccagcctcgaagacctc
ttcaatttctgttcaagaaggttcactatgaagactgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagttattccttattgattttggtttg
gccaaaaagtacagagacaacaggacaaggcaacacataccatacagggaagataaaaac
ctcactggcactgcccggtatgccagcatcaatgcacatcttggcattgagcagagtcgc
cgagatgacatggaatctttaggatatgttttgatgtattttaatagaaccagtctgcca
tggcaagggctaaaggctgcaacaaagaaacaaaaatatgaaaagattagtgaaaagaag
atgtccactcctgttgaagttttgtgtaaggggtttcctgcagaatttgccatgtactta
aattactgtcgtgggctgcgctttgaggaagctccggattacatgtatctgaggcagctg
ttccgcatcctcttcaggaccctgaaccaccagtatgactacacgtttgattggacgatg
ttaaagcagaaagcagcccagcaggcagcctcttccagtgggcagggtcagcaggcccaa
acccccacaggtttctaa

DBGET integrated database retrieval system