KEGG   Rattus norvegicus (rat): 113929
Entry
113929            CDS       T01003                                 

Gene name
Nup88, Nup84, Prei2
Definition
(RefSeq) nucleoporin 88
  KO
K14318  nuclear pore complex protein Nup88
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    113929 (Nup88)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    113929 (Nup88)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    113929 (Nup88)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     113929 (Nup88)
SSDB
Motif
Pfam: Nup88 FliJ
Other DBs
NCBI-GeneID: 113929
NCBI-ProteinID: NP_446068
RGD: 620182
Ensembl: ENSRNOG00000006126
UniProt: O08658
Position
10q24
AA seq 742 aa
MAAAAGPVGDGELWQSWLPNHVVFLRLREGLKNQSPAEADKPATSTSPSCPPLPPHLPTR
NLVFGLGGELFLWDAEGSAFLVVRLRGPSGGSVEPPLSQYQRLLCINPPLFEIHQVLLSP
TQHHVALIGTKGLMALELPQRWGKDSEFEGGKATVNCSTIPIAERFFTSSTSLTLKHAAW
YPSEMLDPHIVLLTSDNVIRIYSLREPQTPTKVIVLSEAEEESLILNKGRAYTASLGETA
VAFDFGPLVTVSKNMFEQKDREAVAYPLYILYENGETFLTYVSLLHSPGNIGKLLGPLPM
HPAAEDNYGYDACAILCLPCVPNILVIATESGMLYHCVVLEGEEDDDQTLEKSWDPRADL
IPSLYVFECVELELALKLASAEDDPFASDFSCPIKLHRDPKCPSRYHCSHEAGVHSVGLT
WIHKLHKFLGSDEEDKDSLQELTAEQKCFVEHILCTKPLPCRQPAPIRGFWIVPDILGPT
MICITSTYECLIRPLLSTVHPASPPLLCTREDAGVAESPLRILAEAPDSFEKHIKRILQR
SAANPALLKSSEKDLAPPPEECLQLISRATQVFREQYILKQDLAKEEIQRRVKLLCDQKR
KQLEDLNYCREERKSLREMAERLADKYEEAKEKQEDIMNRMKKVLHSFHTQLPVLSDSER
DMKKELQLIPDQLRHLGNAIKQVTMKKDYQQRKMEKVLSPQKPTITLSAYQRKCIQSILK
EEGEHIREMVKQINDIRNHVNF
NT seq 2229 nt   +upstreamnt  +downstreamnt
atggcggctgccgcggggcctgtgggcgatggggagctgtggcagagctggcttcctaac
cacgtcgtgttcttgcgactccgcgaaggtctgaaaaaccagagtccagccgaagcggat
aaaccagcgacttcgacttcaccttcatgcccgcctctgccgccgcatttgccgacgaga
aacctggtcttcggcctcggaggggaactgttcctgtgggacgcagaaggcagtgccttt
ttggtggttcgccttcgaggccccagtggtggcagcgtggagccccctctctcccagtat
cagagattactttgcattaatccacccttgtttgaaattcatcaagtcttgttaagtcca
acacaacatcatgtagcacttataggaacaaaaggacttatggcattagaattacctcag
agatgggggaaggattctgaatttgaaggtgggaaagcaactgtgaattgtagcaccatc
ccgattgctgagagatttttcaccagttctacctctctgactctgaagcatgctgcatgg
tatcccagtgagatgctggatccccacatagtgctgttgacgtcagacaatgtgataaga
atttactctctgcgtgagcctcagacaccaactaaggtgattgtactttcggaagcagaa
gaggaaagtttaatactcaataaaggaagagcatacacagcatctctaggagagacggca
gtggcgtttgacttcgggcctctggtgaccgtctcaaagaatatgtttgaacagaaagac
agagaagcagtggcgtatccactgtacattctgtatgagaacggggagaccttcctcacc
tacgtcagcctgttacacagcccagggaatattgggaagctgttgggcccactgcctatg
catcctgcagctgaagataactatggttacgatgcctgtgctatactctgtttgccctgt
gttcccaacatcttagtcattgcgactgagtcaggaatgctgtaccactgtgttgtacta
gagggagaagaagatgacgatcaaacgttagaaaaatcctgggatcccagggccgacctc
atcccttctctgtacgtgtttgagtgtgttgagttagaacttgccctgaaactggcgtct
gcagaggatgatccctttgcttctgacttttcctgtccaattaaactgcatagagatccc
aagtgtccttcgagataccactgtagccatgaagctggcgtacacagcgttgggctgact
tggattcacaaactgcacaaattccttggatcagatgaagaagacaaggatagtttacag
gagctcactgctgagcagaaatgctttgtggagcacattctttgtacaaagccgttgcca
tgcaggcagccagctccaattcgaggattctggatcgtcccggatatcctggggcccaca
atgatctgcatcaccagtacctatgaatgtctcataaggcctttattaagtacagtccac
ccagcatctcctcccctgctctgcacccgggaagatgctggagtggcagagtctccactg
cgcatcctggcggaagccccagactcctttgagaagcatattaaacgaatcctgcagcgc
agcgccgccaacccggcacttctcaagtcatctgagaaggacttggctccccctcccgag
gagtgtcttcagctgatcagcagggccacccaggtgttccgagaacagtacatcctcaag
caggacctggccaaggaggagattcagcggagggtcaaattattatgtgaccagaagagg
aagcaactagaagatctcaattactgtcgagaggagagaaaaagtctccgggaaatggcc
gagcgcttagctgacaaatatgaagaagccaaagaaaaacaagaagatatcatgaacagg
atgaaaaaagtgcttcacagttttcacactcagctcccagtcctctcggacagtgagaga
gacatgaagaaagagctacagctgatacctgaccaacttcgacatctaggcaatgccatc
aaacaggttactatgaaaaaagattatcaacagcgaaagatggaaaaagtgctgagtcct
cagaaacccaccattactctcagtgcctaccagcgaaagtgcattcagtccatcctgaaa
gaagagggtgaacacatacgagaaatggtgaagcaaatcaatgatatccgaaatcatgtc
aacttctga

DBGET integrated database retrieval system