KEGG   Rattus norvegicus (rat): 113936
Entry
113936            CDS       T01003                                 

Gene name
Cpb2
Definition
(RefSeq) carboxypeptidase B2 precursor
  KO
K01300  carboxypeptidase B2 [EC:3.4.17.20]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno04972  Pancreatic secretion
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    113936 (Cpb2)
  09154 Digestive system
   04972 Pancreatic secretion
    113936 (Cpb2)
   04974 Protein digestion and absorption
    113936 (Cpb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    113936 (Cpb2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.20  carboxypeptidase U
     113936 (Cpb2)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   113936 (Cpb2)
SSDB
Motif
Pfam: Peptidase_M14 Propep_M14 Esterase DXPR_C
Other DBs
NCBI-GeneID: 113936
NCBI-ProteinID: NP_446069
RGD: 71035
Ensembl: ENSRNOG00000010935
UniProt: Q9EQV9
Position
15
AA seq 422 aa
MKLYGLGVLVAIILYEKHGLAFQSGHVLSALPRTSRQVQLLQNLTTTYEVVLWQPVTAEF
IEKKKEVHFFVNASDVNSVKAYLNASRIPFNVLMNNVEDLIQQQTSNDTVSPRASSSYYE
QYHSLNEIYSWIEVITEQHPDMLQKIYIGSSYEKYPLYVLKVSGKEHRVKNAIWIDCGIH
AREWISPAFCLWFIGYVTQFHGKENTYTRLLRHVDFYIMPVMNVDGYDYTWKKNRMWRKN
RSVHMNNRCVGTDLNRNFASKHWCEKGASSFSCSETYCGLYPESEPEVKAVADFLRRNIN
HIKAYISMHSYSQQILFPYSYNRSKSKDHEELSLVASEAVRAIESINKNTRYTHGSGSES
LYLAPGGSDDWIYDLGIKYSFTIELRDTGRYGFLLPERFIKPTCAEALAAVSKIAWHVIR
NS
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgaagctttatggccttggagtcctggtagccatcatcctctatgagaagcatggcctt
gcctttcagagtggccatgttctatctgctctccctcgaacctccaggcaagttcaactt
cttcagaatctcactacaacttacgaggttgttctctggcagccagtgacagctgaattc
attgagaagaaaaaggaagtccacttctttgtgaatgcgtctgatgtcaacagtgtcaaa
gcctatttaaatgcgagcagaattccatttaacgtcctgatgaacaacgtggaggatcta
attcaacagcagacgtccaatgacactgttagcccccgagcctcctcctcatactatgaa
cagtatcactcgttaaatgaaatctattcctggatagaagttataactgaacagcaccct
gacatgctccagaaaatctacattggatcctcatatgaaaagtacccactttatgtgtta
aaggtctcaggaaaggaacacagagtcaaaaatgccatatggatcgactgtggaatccat
gccagagagtggatttcaccagctttctgcttgtggttcataggctatgtaacgcaattc
catgggaaagaaaatacatacaccagacttctgaggcacgtggatttctacattatgcca
gtgatgaatgtggacggctacgactacacgtggaaaaagaatcgaatgtggagaaagaac
cgctctgtccacatgaacaaccgctgcgtgggcacagacctgaacaggaacttcgcttcc
aaacactggtgtgagaaaggcgcatcaagtttctcctgctctgagacctactgtggactt
taccctgagtctgagccagaggtgaaggcagtggctgacttcctgaggagaaatatcaac
cacattaaagcttacatcagtatgcactcatactcccagcaaatactgtttccctattcc
tacaacagaagcaaaagcaaggaccacgaggaactgtctctagtggccagcgaagcagtt
cgtgccattgaaagtattaataaaaacaccaggtacacacatggcagtggctcagaaagt
ttatatctagctcctggaggttctgatgattggatctatgatttgggcatcaaatattcg
tttacgattgaacttcgggatacaggcagatacgggttcttgctgcctgagagattcatc
aaacccacttgcgcagaagctttggccgcagtctctaaaatagcttggcatgtcatcagg
aacagttaa

DBGET integrated database retrieval system