KEGG   Rattus norvegicus (rat): 113947Help
Entry
113947            CDS       T01003                                 

Gene name
Maged2
Definition
(RefSeq) MAGE family member D2
  KO
K24127   
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: MAGE
Motif
Other DBs
NCBI-GeneID: 113947
NCBI-ProteinID: NP_001258038
RGD: 70899
Ensembl: ENSRNOG00000002449
UniProt: Q3B7U1
Position
5q13
AA seq 618 aa AA seqDB search
MSDTSESGADPARSQGKASEKDSGSMMQDLLTVTQNLEVSETPKAKKAPEVSEAAKVPKA
SGNPKATEVSKAPEASEAAATQASPTTQLSETQVLAAENKSPAADTKTQKADLQAMTMPA
TQTKTVSSVTDSKVNTKTPETEAPASQSGADEPEPEGAAVQVQENQDTRPKVKAKNTEKG
KHLEGEEDGNSDQSQTSETTGGRRVSKALMASMARRASRGPIAFWARRASRTRLAAWARR
ALLSLRSPRARRGKARRRAAKLQSSQEPEAPPPRDVALLQGRANDLVKYLLAKDQTKIPI
RRSDMLKDIIKEYTDVYPEIIERAGYSLEKVFGIQLKEIDKNDHLYILLSTLEPTDAGIL
GTTKDSPKLGLLMVLLSIIFMNGNRSSEAVIWEVLRKLGLRPGIHHSLFGDVKKLITDEF
VKQKYLDYARVPNSNPPEYEFFWGLRSYYETSKMKVLKFACKVQKKDPKEWAAQYREAME
ADLKAAAEAAAEAKARAEIRAQMGIGLGSENAAGPCNWDEADIGPWAKARIQAGAETKAK
AQESSGASAGTGAGASASAGTSVSTSGTAGSGANAGASGGFSTNPSLTASLTFGLFAGLS
GAGASNSSSSGACGFSYK
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacacaagtgagagtggtgcagatccagctcgctctcagggcaaagcttcagaa
aaggacagcggctccatgatgcaggacctgttgactgtgacccagaacttggaggtctca
gagacaccaaaggctaaaaaggcaccagaggtctcagaagctgcaaaggtccccaaagcc
tctgggaacccaaaggcgacagaggtctcaaaggccccagaggcttcggaggcagctgcc
acccaggcctcacctaccacacagctgagtgagacccaggttctggcagctgaaaacaag
agtccagcagctgacaccaagacacagaaggctgacctgcaggctatgacaatgcctgca
acccagaccaaaacggtcagttctgttaccgattctaaggtcaatacaaagactccggag
accgaggctcctgcctctcagtctggggcagatgaaccagagcctgagggtgcagctgtc
caagttcaggagaatcaggatactcggcccaaggtcaaagccaagaataccgaaaagggg
aaacacctggaaggggaagaggacggcaacagtgatcagagtcagacttcagaaaccaca
ggtggtcggagggtctcaaaggccctaatggcctccatggcccgtagagcttcaagggga
cccatagcgttctgggcccgcagggcatcaaggactcggttggctgcctgggctcggaga
gctttgctctccctgaggtcacctagagctcggagaggcaaggcccgaagaagagctgcc
aagctgcagtcatcccaggaacccgaagcacccccacccagagatgtggcccttttacaa
ggaagggcaaatgatttggtgaagtacctgttggctaaagatcagacaaagattcccatc
aggcgctcagatatgctgaaggacatcatcaaagaatatacggatgtataccctgaaatc
attgaacgagcaggctattccttggagaaggtatttggaatccaactgaaagaaattgac
aagaatgaccacttgtatattcttctcagtaccttagagccaactgatgcaggcatcctg
ggaacgaccaaggactcacctaagctgggcctcctcatggtgcttcttagcatcatcttc
atgaatggaaatcggtccagtgaggctgtcatctgggaggtgctgcgcaagttggggctg
cgccctgggatacatcactcactctttggggatgtgaagaagctcattactgatgagttt
gtgaagcagaagtacctggactacgctagagtacccaatagcaatcctcctgagtatgag
ttcttctggggcctacgctcttactacgagaccagcaagatgaaagttctcaagtttgcc
tgtaaggtgcaaaagaaagatcccaaagaatgggcagctcagtaccgagaggcaatggaa
gcagatttgaaggctgcggctgaggctgctgccgaagccaaggcgagggctgagattaga
gctcagatgggcattgggcttggctctgagaatgctgctgggccctgcaactgggatgaa
gctgatattggaccctgggcaaaggcccggatccaggcgggagctgaaactaaagccaaa
gcccaagaaagtagtggtgccagtgctggtactggtgccggtgccagtgccagtgctggt
accagtgtcagtaccagtggcactgctggttctggtgctaatgctggggccagtgggggc
ttcagtaccaaccccagtctgactgccagtctcacgtttgggctcttcgctggccttagt
ggagctggggccagtaacagtagcagctctggtgcctgtggtttctcctacaagtga

DBGET integrated database retrieval system