KEGG   Rattus norvegicus (rat): 113948
Entry
113948            CDS       T01003                                 

Gene name
Bbs2
Definition
(RefSeq) Bardet-Biedl syndrome 2
  KO
K16747  Bardet-Biedl syndrome 2 protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    113948 (Bbs2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   BBSome complex
    113948 (Bbs2)
SSDB
Motif
Pfam: BBS2_C BBS2_Mid BBS2_N FG-GAP VCBS Itfg2
Other DBs
NCBI-GeneID: 113948
NCBI-ProteinID: NP_446070
RGD: 71091
Ensembl: ENSRNOG00000019020
UniProt: Q99MH9
Position
19p12
AA seq 721 aa
MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQAGKVFIHNPHMRSQHFSTSRVFQS
PLESDVSLLNINQTVSCLGAGVLNPELGYDTLLVGTQTSLLAYDIYNNSDLFYREVADGA
NALVLGTLGDIAPPLAIIGGNCALQGFDHEGNDLFWTVTGDNVHSLALCDFDGDGKSELL
VGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTARYWRIKS
KNHAMSIHAFDINSDGVCELITGWSNGKVDARSDRTGEVIFKDNFSSAVAGVVEGDYRMD
GHVQLICCSVDGEIRGYLPGTAEMKGNLLDTSVEQGLIRELSQKKQNLLLELRNYEENTK
AELSSPLNEADGQKGIIPANTKLHTALSVNLGNDAQDAHAELRISTSNDTIIRAVLIFAE
GIFAGESHVVHPSTHNLSSSIRVPITPPKDVPVDLHLKTFVGYRSSTQFHVFELIRQLPR
FTMYALTSPDAASEPVSFVNFIVVERAQRMVTWLNQNFLLPEDSNIQNAPFHVCFTSLRN
GGQLYIKMKPSGEITVNTDDIDLAGDIIQSMASFFAIEDLQVEADFPVYFEELRKVLLKV
DEYHSVHQKLSANMADNSNLIRSLLVRAEDARLMRDMKTMKTRYMELYDLNKDLLNGYKI
RCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVISACRDAIRSNNINTLFRIMRVGTAP
S
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgctgctgcctgtgttcaccctgaaactgcgccacaaaatcagcccccgcatggtggcc
atagggcgctacgacgggactcacccgtgcttggcggccgccacccaagcgggcaaggtt
tttattcataatcctcacatgcggagccagcattttagtacatccagagtgttccagagc
cctcttgagtctgatgtgtccctcctcaacattaaccagacagtcagctgcctcggcgcc
ggagtcttgaaccctgagcttggctatgatactctcttagtggggacacagaccagtctt
ttggcttacgacatctacaataattcagatttgttctacagagaggtcgcggatggggca
aatgcccttgtgttggggactctgggggacattgccccgccccttgcaatcatcggtgga
aattgtgctcttcagggttttgatcacgaaggaaatgacctcttttggacggttactgga
gacaatgttcattccttggctctgtgtgactttgacggtgatgggaagtcagagcttctt
gttgggtctgaagattttgacattcgagtttttaaagaagatgagattgtggcagaaatg
acagagacagagatagtcacctctctgtgtcccatgtacggcagtcggtttggttatgcc
ctttctaatggcacagttggagtttatgacaaaacagcccggtactggagaattaaatcc
aaaaaccatgccatgagcatccatgcttttgacatcaattctgatggagtgtgtgaattg
atcactgggtggtctaatgggaaggttgacgctcgcagtgaccggaccggagaggtcata
tttaaagacaacttctcttctgccgttgctggtgtggtggagggagattaccggatggat
ggccacgtacagttaatctgctgctcagtggatggggaaatccgaggctacctgccaggc
acagctgagatgaaggggaacctcctggacacaagtgtggagcagggcctgatccgagag
ctcagtcagaaaaagcagaacctgttgctagaactgcgcaactacgaggagaacaccaag
gcagaactgagcagtcccctgaatgaggccgatggacagaaaggcataatcccagccaat
accaagctccacacagccctctcagtcaatctggggaatgatgcacaagacgcacatgcg
gaattacgcatttccacttctaatgacacaatcatccgggcagtactcatttttgcagag
ggaatttttgcgggtgaaagccacgtggtccaccccagcactcacaacctttccagctcc
atccgggtaccaattacgcctcccaaagatgtccctgtggatctgcacttgaaaaccttc
gtgggttacagaagcagcacccagttccatgtgtttgaactgataaggcagctgcccaga
tttaccatgtatgcactgacaagcccagacgcagcgagcgagcctgtcagtttcgtgaac
ttcatcgtagtagagcgggcacagaggatggtcacgtggctcaaccagaacttcttgttg
ccagaagacagtaacattcagaacgccccgtttcacgtctgtttcacgtccttacgcaac
ggtggccagctctacataaaaatgaaaccaagtggtgagatcacggtgaatactgatgat
attgatcttgctggtgatatcatccagtcgatggcatccttttttgctattgaagacctt
caggtagaagcagatttccctgtctacttcgaggagttacggaaagtgctgttgaaggta
gatgagtaccattcagtgcatcaaaagctcagcgccaacatggctgataattctaacctc
atccgaagtttgctggtcagagcggaggatgctcgtctgatgagagacatgaaaacaatg
aagactcgttatatggagctctatgaccttaataaagatttgctaaatggatataagatt
cgttgtaacaaccacactgaactgctaggaaacctgaaggcggtgaaccaagcaatccag
agggcaggccgtctgcgagttggaaagccaaagaaccaggtgatcagtgcttgtcgggat
gcgattcgcagtaacaacatcaacacactcttcagaatcatgcgggtggggactgctcct
tcctag

DBGET integrated database retrieval system