KEGG   Rattus norvegicus (rat): 113955Help
Entry
113955            CDS       T01003                                 

Gene name
Gpnmb
Definition
(RefSeq) glycoprotein nmb
  KO
K20732  transmembrane glycoprotein NMB
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    113955 (Gpnmb)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Others
    113955 (Gpnmb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PKD
Motif
Other DBs
NCBI-GeneID: 113955
NCBI-ProteinID: NP_579832
RGD: 71008
Ensembl: ENSRNOG00000008816
UniProt: Q9QZF6
Position
4q24
AA seq 572 aa AA seqDB search
MESLCGVLVFLLLAAGLPLQAAKRFRDVLGHEQYPDHMRENNQLRGWSSDENEWDEQLYP
VWRRGEGRWKDSWEGGRVQAALTSDSPALVGSNITFVVNLVFPRCQKEDANGNIVYERNC
RSDLELASDPYVYNWTTGADDEDWEDNTSQGQHLRFPDGKPFPRPHGRKKWNFVYVFHTL
GQYFQKLGQCSARVSINTVNLTVGPQVMEVIVFRRHGRAYIPISKVKDVYVITDQIPIFV
TMYQKNDRNSSDETFLRDLPIFFDVLIHDPSHFLNYSAISYKWNFGDNTGLFVSNNHTLN
HTYVLNGTFNFNLTVQTAVPGPCPSPTPSPSSSTSPSPASSPSPTLSTPSPSLMPTGYKS
MELSDISNENCRINRYGYFRATITIVDGILEVNIIQVADVPIPTLQPDNSLMDFIVTCKG
ATPTEACTIISDPTCQIAQNRVCSPVAVDELCLLSVRRAFNGSGTYCVNFTLGDDASLAL
TSALISIPGKDLGSPLRTVNGVLISIGCLAMFVTMVTILLYKKHKTYKPIGNCTRNVVKG
KGLSVFLSHAKAPFSRGDREKDPLLQDKPWML
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtctctgcggggtcctggtatttctgctgctggctgcaggactgccgctccag
gcggccaagcggttccgtgatgtgctgggccatgagcagtatccggatcacatgagggag
aacaaccaattacgtggctggtcttcagatgaaaatgaatgggatgaacagctgtatcca
gtgtggaggaggggagagggcagatggaaggactcctgggaaggaggccgtgtgcaggca
gccctaaccagtgattcaccggccttggtgggttccaatatcaccttcgtagtgaacctg
gtgttccccagatgccagaaggaagatgccaacggcaatatcgtctatgagaggaactgc
agaagtgatttggagctggcttctgacccgtatgtctacaactggaccacaggggcagac
gatgaggactgggaagacaacaccagccaaggccagcacctcaggttccccgacgggaag
cccttccctcgcccccacggacggaagaaatggaacttcgtctacgtcttccacacactt
ggtcagtattttcaaaagctgggtcagtgttcagcacgagtttctataaacacagtcaac
ttgacagttggccctcaggtcatggaagtgattgtctttcgaagacacggccgggcatac
attcccatctccaaagtgaaagacgtgtatgtgataacagatcagatccctatattcgtg
accatgtaccagaagaatgaccggaactcgtctgatgaaaccttcctcagagacctcccc
attttcttcgatgtcctcattcacgatcccagtcatttcctcaactactctgccatttcc
tacaagtggaactttggggacaacactggcctgtttgtctccaacaatcacactttgaat
cacacgtatgtgctcaatggaaccttcaactttaacctcaccgtgcaaactgcagtgccg
ggaccatgcccctcacccacaccttcgccttcttcttcgacttctccttcgcctgcatct
tcgccttcacccacattatcaacacctagtccctctttaatgcctactggctacaaatcc
atggagctgagtgacatttccaatgaaaactgccgaataaacagatatggttacttcaga
gccaccatcacaattgtagatggaatcctagaagtcaacatcatccaggtagcagatgtc
ccaatccccacactgcagcctgacaactcactgatggacttcattgtgacctgcaaaggg
gccactcccacggaagcctgtacgatcatctctgaccccacctgccagatcgcccagaac
agggtgtgcagcccggtggctgtggatgagctgtgcctcctgtccgtgaggagagccttc
aatgggtccggcacgtactgtgtgaatttcactctgggagacgatgcaagcctggccctc
accagcgccctgatctctatccctggcaaagacctaggctcccctctgagaacagtgaat
ggtgtcctgatctccattggctgcctggccatgtttgtcaccatggttaccatcttgctg
tacaaaaaacacaagacgtacaagccaataggaaactgcaccaggaacgtggtcaagggc
aaaggcctgagtgtttttctcagccatgcaaaagccccgttctcccgaggagaccgggag
aaggatccactgctccaggacaagccatggatgctctaa

DBGET integrated database retrieval system