KEGG   Rattus norvegicus (rat): 113959
Entry
113959            CDS       T01003                                 

Gene name
C5ar1, C5r1
Definition
(RefSeq) complement C5a receptor 1
  KO
K04010  C5a anaphylatoxin chemotactic receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04610  Complement and coagulation cascades
rno05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113959 (C5ar1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    113959 (C5ar1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    113959 (C5ar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    113959 (C5ar1)
   04090 CD molecules [BR:rno04090]
    113959 (C5ar1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Anaphylatoxin
    113959 (C5ar1)
CD molecules [BR:rno04090]
 Proteins
  113959 (C5ar1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 113959
NCBI-ProteinID: NP_446071
RGD: 70553
Ensembl: ENSRNOG00000047800
UniProt: P97520
Position
1q21
AA seq 352 aa
MDPISNDSSEITYDYSDGTPNPDMPADGVYIPKMEPGDIAALIIYLAVFLVGVTGNALVV
WVTAFEAKRTVNAIWFLNLAVADLLSCLALPILFTSIVKHNHWPFGDQACIVLPSLILLN
MYSSILLLATISADRFLLVFKPIWCQKFRRPGLAWMACGVTWVLALLLTIPSFVFRRIHK
DPYSDSILCNIDYSKGPFFIEKAIAILRLMVGFVLPLLTLNICYTFLLIRTWSRKATRST
KTLKVVMAVVTCFFVFWLPYQVTGVILAWLPRSSSTFQSVERLNSLCVSLAYINCCVNPI
IYVMAGQGFHGRLRRSLPSIIRNVLSEDSLGRDSKSFTRSTMDTSTQKSQAV
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggaccccataagtaacgacagcagtgaaatcacctatgattactctgatggaacccca
aatcctgacatgcctgcagatggcgtttacattccgaagatggaacctggggacattgca
gcccttattatctacttggccgtgttcctggtaggagttaccggaaatgccctggtggtg
tgggtgacagcctttgaggccaaacgtactgtcaacgccatttggtttctgaatctggcg
gtggccgacctcctctcgtgcttggcactgcctatcctgtttacgtccattgtaaagcat
aaccactggcccttcggtgaccaggcctgtatagtcctgccctcgctcattctgctcaac
atgtactccagcatcctgctgctggccactattagtgccgaccgtttcctgctggtgttc
aaacccatctggtgtcagaagttccgccggcctggcctggcctggatggcttgcggagta
acctgggtcttagcattgctcctcaccattccgtccttcgtgttccggcggatacataag
gacccctactcagatagcattctatgtaatattgactatagtaagggtccgttcttcata
gagaaggctatagccatcctgcggctgatggtgggtttcgtgttgcctctgctcactctt
aacatctgctacaccttcctcctgatccggacctggagtcgcaaggccacgcgctccacc
aagacgctcaaagtggtgatggcggtggtcacatgtttctttgtcttctggctaccctac
caggtaacaggggtgatattagcttggctgccccggtcctcatccacttttcagtcagtg
gagaggctgaactccttgtgcgtttccctggcctacatcaactgctgtgttaaccctatc
atctacgtcatggctggccagggtttccatgggagactccgaaggtcactccccagcatc
atacgaaacgtgctctctgaggactccttgggcagggacagcaagagtttcactcggtcc
acgatggatacctccacccagaagagtcaggcagtgtag

DBGET integrated database retrieval system