KEGG   Rattus norvegicus (rat): 113970
Entry
113970            CDS       T01003                                 

Gene name
Magi2
Definition
(RefSeq) membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
  KO
K05629  atrophin-1 interacting protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    113970 (Magi2)
   04151 PI3K-Akt signaling pathway
    113970 (Magi2)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 MAGI_u1 WW Guanylate_kin DUF6288 MAGI_u5
Other DBs
NCBI-GeneID: 113970
NCBI-ProteinID: NP_446073
RGD: 621855
Ensembl: ENSRNOG00000013962
UniProt: O88382
Position
4
AA seq 1277 aa
MSKSLKKKSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKL
VSEELLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGS
VDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYED
NYYGTPKPPAEPAPLLLNVTDQILPGATPSAEGKRKRNKSVTNMEKASIEPPEEEEEERP
VVNGNGVVITPESSEHEDKSAGASGETPSQPYPAPVYSQPEELKDQMDDTKSTKPEENED
SDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPAEECKENELPYGWEKIDDP
IYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTELGTKPLQAPGFREKPLFTRDASQL
KGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVC
VLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNG
RHNYETYLEYISRTSQSVPDITDRPPHSLHSMPADGQLDGTYPPPVHDDNVSVASSGATQ
AELMTLTIVKGAKGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHT
EVVDILKDCPVGSETSLIIHRGGFFSPWKTPKPMVDRWENQGSPQTSLSAPAVPQSLPFP
PALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVH
LRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRY
VIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYANSNHAA
PSNNASPPEGFASHSLQTSDVIIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDG
SPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNNPTSAPS
SEKQSPMAQQHSPLAQQHSPLAQPSPATPNSPVAQPAPPQPLQLQGHENSYRSEVKARQD
VKPDIRQPPFTDYRQPPLDYRQPPGGDYSQPSPLDYRQHSPDTRQYPLSDYRQPQDFDYF
TVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMT
HARAIELIKSGGRRVRLLLKRGTGQVPEYGMVPSSLSMCMKSDKHGSPYFYLLGHPKDTT
NPTPGALPLPPPQACRK
NT seq 3834 nt   +upstreamnt  +downstreamnt
atgtccaaaagcttgaaaaagaaaagccactggactagcaaagtccacgagagtgtcatt
ggcagaaacccggagggccagctgggctttgaactgaaggggggcgccgaaaacggacag
ttcccctacctgggggaggtgaagccgggcaaggtggcctatgaaagcggcagcaagttg
gtgtccgaggagctgctgctggaggtgaacgagacccccgtggcggggctcaccatcagg
gatgttctggccgtgatcaaacactgcaaggaccccctccggctcaagtgtgtcaagcaa
ggaggaattgttgataaggatcttcgtcactacctcaacttaagatttcagaagggttct
gttgaccacgaactacagcaaatcatccgtgacaacctctacctccgcacagtgccatgc
accacaaggccacataaggagggtgaggtccctggagtggactacattttcataaccgtt
gaggactttatggaattggagaaaagcggtgctctcctagaaagtgggacctatgaagac
aactattacggcactccaaagcctccagctgaaccagcaccattattattaaatgtaaca
gatcagatactcccgggagctactccaagtgctgaggggaagcggaaaagaaataagtct
gtgaccaacatggagaaagcaagtatagagccaccggaggaagaggaggaagaaaggcct
gtggtcaacggaaatggcgtcgtcataacaccagaatccagtgaacatgaagacaaaagt
gcaggtgcctcaggggagaccccctcccagccttaccctgcaccagtgtacagtcagcct
gaagagctcaaggaccagatggatgatacaaagtcaacaaagcccgaggagaatgaggac
tccgacccattgcctgataactgggaaatggcctacacagagaagggtgaagtctacttc
attgaccataacacaaagacaacatcatggctggatccacgacttgccaaaaaggctaag
cctgcagaggagtgcaaggaaaatgagcttccatatggctgggaaaaaatcgatgatcct
atatatggcacttactatgtcgaccacataaatagaagaacacagtttgaaaaccctgtc
ctggaagcaaaaaggaagctacagcaacataacatgccccacacagaacttggaacaaag
cccctgcaggccccaggtttccgagaaaagccactcttcacccgggatgcatcccagttg
aagggaacattcctcagcaccaccctcaaaaagagcaacatgggctttgggtttacgatc
atcggtggagatgagccggacgagtttctacaggtgaagagtgtgatcccggatgggccc
gccgcacaggatgggaaaatggagacaggtgatgtcattgtctatattaatgaagtttgt
gtccttggacacactcatgcagatgttgtcaaacttttccagtctgttcctattggtcag
agcgtcaacctggtgttgtgtcgtggctaccctttgccctttgatcctgaagaccctgcc
aacagcatggtgccaccccttgcaataatggagaggccacctccggtgatggtcaatgga
agacataactatgaaacatatttggaatacatttctcggacctcacagtcggtcccagat
attacagaccggccacctcattctttgcactccatgccagctgatggccaactagatggc
acatatccaccacccgtccacgatgacaatgtgtctgtggcttcatctggagccactcaa
gctgaacttatgaccttaaccattgtgaaaggtgccaagggatttggctttactattgcc
gacagtcccacgggacagcgggtgaaacaaatacttgacattcagggatgccccgggctg
tgtgaaggagacctcattgttgagatcaatcaacagaatgtacagaacctgagccataca
gaagtggttgatatacttaaggactgccccgtcggaagcgagacttctctaatcatccat
cgaggaggtttcttttctccatggaaaactccaaagcctatggtggaccggtgggagaac
caaggcagccctcaaacaagtttatctgctccggccgtcccacagagcctgcccttccca
cctgcccttcataggagctcctttcctgactcaacagaggcctttgacccacggaagcct
gacccgtatgagctctacgagaaatcgagagccatttatgaaagtaggcaacaagtgcca
cccaggaccagttttcgaatggattcctctggtccagattataaggaattggatgttcac
cttcggaggatggagtctggatttggcttcagaatccttgggggagacgagcccggacag
cctattttgatcggagctgtcattgcgatgggctcagctgacagagacggccgtctgcac
ccaggagacgagcttgtctacgtggatgggatcccggtggctggcaagacccaccggtat
gtcatcgacctcatgcaccatgcggcccgcaacgggcaggttaacctcactgtgagaaga
aaggtgctatgtggaggggagccctgcccagagaatgggaggagtccaggctctgtatca
acacaccacagctctccccgcagtgactatgccacctacgccaacagcaaccacgcggcc
cccagtaacaatgcctcaccccctgaaggctttgcctcgcacagcctgcagaccagtgac
gtcatcattcaccgaaaggaaaacgaaggcttcggcttcgtcatcatcagctccctgaac
aggcctgagtctggagccaccataaccgtgccccataaaatcggacgaatcatcgatggg
agccctgcagatcgctgcgcaaaactcaaagtgggcgaccggatcttagcagtcaacggc
cagtctatcatcaacatgcctcacgctgacatcgtgaagctcatcaaggatgcgggtctc
agcgtcaccctccgcatcattcctcaggaggagctcaacaacccaacatcagcacccagt
tcagagaagcagagccccatggcccagcagcacagccctctggcccagcagcacagccct
ctggcccagccgagcccagccacccccaacagcccagttgcacagccagctcctcctcaa
cctctccagctgcaaggacatgaaaatagttacaggtcagaagttaaagcaaggcaagat
gtgaagccagacatccggcagccgcccttcacagactacaggcagccgccactggactac
aggcaacccccgggaggggactactcgcagccctcacccttggactacaggcagcactcc
ccagacaccaggcagtaccctctgtcagactacaggcagccacaggatttcgattatttc
actgtggacatggagaaaggagccaaaggatttggattcagcatccgtggaggaagggaa
tacaaaatggatctgtacgtgttgagattggcggaggatgggccagccataaggaacggc
aggatgagggtgggagatcagatcatcgaaataaatggggaaagcacacgagacatgacc
cacgccagagcaatagaactcatcaagtcgggaggaagaagagtgcggttgctgctgaaa
cgaggcacggggcaggtcccagagtatggaatggtgccttccagcctctccatgtgcatg
aaaagtgacaagcatgggtccccatatttctacttactgggccaccctaaagacacgacg
aaccctacgcctggagcgctgccgctgccgccgccccaggcctgccggaagtag

KEGG   Rattus norvegicus (rat): 245903
Entry
245903            CDS       T01003                                 

Gene name
Magi3
Definition
(RefSeq) membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3
  KO
K06112  membrane-associated guanylate kinase-related
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    245903 (Magi3)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 WW Guanylate_kin DUF6288 Tricorn_PDZ MAGI_u1
Other DBs
NCBI-GeneID: 245903
NCBI-ProteinID: NP_620784
RGD: 621362
Ensembl: ENSRNOG00000019885
UniProt: Q9JK71
Position
2
AA seq 1470 aa
MSKTLKKKKHWLSKVQECAVSWAGPPGDLGAEIRGGAERGEFPYLGRLRDEPGGGGGTCC
VVSGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLS
LQFQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALL
ESGTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPE
EEEDEDKEAVNGSGSMETREMHSESSDCWMKTVPSYNQTNRSMDFRNYMMRDENLEPLPK
NWEMAYTDTGTIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYY
VDHLNQKTQFENPVEEAKRKKQIGQAETHSAKTDVERAHFTRDPSQLKGVLVRASLKKST
MGFGFTIIGGDRPDEFLQVKNVLKDGPAAQDGKMAPGDVIVDINGNCVLGHTHADVVQMF
QLVPVNQYVNLTLCRGYALPDDSEDPVVDIVAATPVINGQSLAKGEACMSTQDFKLGAMV
LDQNGKSGKLLSSDHLNGPSDSNEQRASLASSGSSQPELVTIPLVKGPKGFGFAIADSPT
GQKVKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGP
CSPTKTAKMKTDTKETSGSLETINEPTPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYED
KPPNTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCID
GIPVKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEDESPQAFSQSGSPRLNRTE
LPTRSAPQESYDVILQRKENEGFGFVILTSKSKPPPGVIPHKIGRVIDGSPADRCGRLKV
GDHISAVNGQSIVDLSHDNIVQLIKDAGVTVTLTVVAEEEHHGPPSGTNSARQSPALQHR
PMGQAQATHIPGDRTALEGEVGKDVCSSYRHSWSDHKHLAQPDTAVISVVGSRHSQSLGC
YPVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPTQGI
THTRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDIYSPSSSNVIYDEQPPPLPSSHSAAT
FEESHVPVTEDSLIRVQTCEKAEELKDTVQEKKSTLNGSQPEMKYQSVQKNVSKKDPSRS
HGHGDKNLPKGENGVTRRGRSASPKKSVNRHSEEHLEKIPRPLRSDPKGKSRDRSLSPRK
GENKGQVTIKAGSGQDPCRKDRGRSSSPRKQQKIGGNSLSNTEGKLSEAGSRRAAGLSSD
SPEQLPEGKEKSGVSRKDLKLSQLGKNRTRSPEKRSSKVDEASLPSKKTSDTASRVVSEK
EKGRKPGTGERSRDKTGESVQTSAKPLTQEAGEKMALSKASEVTDRGKERAGGAPESSSP
VKKAPITPGPWRVPRANKVTGTAGMADKQL
NT seq 4413 nt   +upstreamnt  +downstreamnt
atgtcgaagacgttgaagaagaagaagcattggctcagcaaggtgcaggagtgtgcggtg
tcctgggccgggcccccgggcgacttgggcgctgagatccgcggcggcgcggagcgcggc
gagttcccttacctggggcggctccgtgacgagcctggcggcggcggaggcacctgctgc
gtggtctcgggcaaggcgcccagtcctggcgatgtgctgttggaggtgaacgggacgccc
gtcagtgggctcaccaaccgggacaccctggctgtcatccgccacttccgcgagccaatc
cgtctgaagaccgtgaagccaggcaaagtcataaataaagatttgcgacattacctgagt
ctgcagtttcagaaaggatcgattgaccacaaactacagcaggtcatcagagataacctc
tacttgagaaccatcccatgcactacaagggctcccagggatggggaagttccaggggtg
gactataatttcatttctgttgaacaattcaaggcactggaagaaagcggagcattgtta
gaaagtggaacgtatgatggaaatttctatggcacgcccaagcctccagcagagcctagt
cctttccagcccgatccagttgatcaggtcctctttgacaatgagtttgacacagaatcc
caaagaaaacgaactacatctgtcagcaagatggaaaggatggacagctctctccctgag
gaagaggaagatgaggacaaagaagctgtcaatggcagcggaagcatggaaactagagag
atgcattctgagtcgtctgactgctggatgaagactgttccaagttataaccaaacaaat
cgctccatggactttagaaattatatgatgagagacgagaatctggagccgctgcccaaa
aactgggaaatggcctacactgacacaggaacgatctacttcattgatcacaatacgaag
acaaccacctggctggatcctcgtctctgcaagaaagccaaagcccctgaagactgtgag
gatggagagcttccatatggctgggagaaaatagaggaccctcagtatggaacatactat
gttgatcacctcaaccagaaaactcagtttgaaaatccagtggaggaagcgaaaaggaaa
aagcagataggacaggctgaaactcattccgcaaaaacagatgtggaaagagcacacttt
acccgggacccatcccaacttaaaggtgtccttgttcgagcatcactgaaaaaaagcaca
atgggctttggtttcaccattataggtggagatcggcctgatgaatttctacaagtaaaa
aatgtgctcaaagacggtcccgctgctcaggatgggaaaatggcaccaggtgatgttatt
gtagacatcaatggcaactgtgtccttggtcacacccatgcagatgttgtccagatgttt
caattggtacctgtcaaccagtatgtcaaccttactttatgccgtggttatgcacttcct
gacgacagtgaagaccctgttgtggacattgttgctgctacccctgttatcaatggacaa
tcattagcaaagggagaggcgtgcatgagtactcaggattttaaactgggagcaatggtt
ttggatcagaatggaaaatcaggaaaacttttgtccagtgatcatctcaatggcccatca
gattcaaatgagcaaagagcatccctggcttcatcaggcagctcccagcctgaactagtg
actatcccgctggttaagggtcccaaaggcttcgggtttgcaattgccgatagcccaact
gggcagaaggtgaaaatgatactggatagccagtggtgtcaaggccttcaaaaaggggat
atcatcaaagaaatttaccatcagaatgtgcagaatttaacacatctccaagtcgtagaa
gtactgaaacagttcccagtaggtgcagatgtcccgttgcttatcttaagaggaggtcct
tgttcaccaactaaaactgccaaaatgaaaacagatacaaaagaaacttcaggaagtttg
gagactataaatgagcctactccccagcctatgccttttccacccagcataatcagatca
ggatccccgaaattggatccttctgaagtctacctgaaatctaagactttatatgaagat
aaaccacccaacaccaaagacctagatgtctttcttcggaaacaagaatcggggtttggc
ttcagggtgctgggaggagatggacctgaccagtctatatatattggggccatcattccc
ctgggagcagcggaaaaggatggtaggctccgtgctgctgatgaattgatgtgtattgat
gggattcctgttaaagggaaatcacataagcaagtcttggacttaatgaccactgctgct
cgaaatggccacgtgttactcactgtgaggaggaagatcttctatggagagaaacaaccc
gaggatgaaagccctcaagccttctcacagagtggatctcctcgcctaaatcggacagag
cttccaaccaggtctgccccacaggagtcctatgatgttatcttacagaggaaagaaaat
gaagggtttggttttgtcatcctcacctctaaaagcaagccgcccccaggagttattcct
cataaaattggccgggtcatagatggaagtccagctgatcgttgtggaagactgaaagtt
ggagaccacatctctgcggtgaatgggcagtccattgttgacctgtcccatgataatatt
gttcagctcatcaaagatgctggggtcaccgtcacgctgacagtggttgctgaagaagag
catcatggtccaccatcaggaacaaactcagccaggcagagcccagcactgcagcacaga
cccatgggacaggcgcaggccacccacatacctggggacagaactgccctagaaggtgaa
gttgggaaagatgtctgcagctcttacagacactcctggtctgaccacaagcaccttgca
cagccggacaccgcggtgatttccgtggtgggcagtcggcacagtcagagccttgggtgt
taccctgtggagctggagagaggccctcgaggctttgggttcagcctccgaggagggaag
gagtacaacatggggctgttcatccttcgccttgctgaggacgggcctgccatcaaagac
ggcagaattcacgttggtgaccagatcgtggaaatcaatggggaacctacgcaaggcatc
acacacacgcgagccattgagctcattcaggctggcgggaataaagtcctcctccttctg
aggccaggaactggcttgatacctgatcatggtgattgggatatttatagtccttcatct
tccaatgtcatttatgatgaacagccaccacctctcccctcttcacattctgctgccaca
tttgaagagtctcatgtgccagtaactgaagactctctgattagagttcagacatgtgaa
aaggcagaagaattaaaggacactgtacaagaaaagaaaagcactttaaatggaagccag
cctgagatgaagtatcagtctgtccagaaaaatgtgagtaagaaggatccatccagaagt
catgggcatggtgacaagaatctacctaaaggagaaaatggtgttacacggagaggtaga
tctgctagtcccaaaaagtcagttaatcgacattcagaggaacatctggaaaagattccc
aggccccttagaagtgaccccaaaggaaaatctagagaccggtcactcagccctaggaaa
ggagaaaataaaggtcaggtcaccattaaggcgggctctggacaagatccctgtagaaaa
gacagaggacggtcttctagccccaggaagcagcaaaagattggaggcaacagcctgtca
aacactgaaggcaaattatcagaggctgggagccgaagagcagcaggcctctctagtgac
agccctgaacagctcccagaggggaaagaaaagtcaggggtcagcaggaaagatctgaag
ctcagtcagctggggaaaaacagaacaaggtctccagagaaaaggagcagcaaagttgat
gaagcgtctctcccatccaaaaagactagtgacactgctagtagggtagtgtctgaaaag
gagaaaggaaggaagccaggcacaggagaaagaagtagagacaaaacaggagaaagcgtc
cagacctcagcaaagccgctcacgcaggaagcgggagagaagatggcattaagcaaagca
tcagaggtcactgacagaggcaaggagcgtgcagggggcgcacctgagagtagctctcca
gtcaagaaagcacccatcactccaggaccctggagggtgccacgtgcaaataaagtcaca
ggcactgctggcatggctgacaaacagctgtga

KEGG   Rattus norvegicus (rat): 500261
Entry
500261            CDS       T01003                                 

Gene name
Magi1
Definition
(RefSeq) membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
  KO
K05631  atrophin-1 interacting protein 3 (BAI1-associated protein 1)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04530  Tight junction
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    500261 (Magi1)
   04151 PI3K-Akt signaling pathway
    500261 (Magi1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    500261 (Magi1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    500261 (Magi1)
SSDB
Motif
Pfam: PDZ PDZ_6 MAGI_u5 MAGI_u1 PDZ_2 WW Guanylate_kin DUF6288 Tricorn_PDZ Serglycin
Other DBs
NCBI-GeneID: 500261
NCBI-ProteinID: NP_001025216
RGD: 1586025
Ensembl: ENSRNOG00000022060
UniProt: Q4L1J4
Position
4
AA seq 1255 aa
MSKVIQKKNHWTGRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAAEAAGLPGGGE
GPKLAEGELLLEVQGVRVSGLPRYDVLGVIDSCKEAVTFKAVRQGGRLNKDLRHFLNQRF
QKGSPDHELQQTIRDNLYRHAVPCTTRSPREGEVPGVDYSFLTVKEFLDLEQSGTLLEVG
TYEGNYYGTPKPPSQPVSGKVITTDALHSLQSGSKQSTPKRTKSYNDMQNAGIVHTENEE
EEDVPEMNSSFTADSGDQDEPTLQEATLPPVNSSALAAPITDPSQKFPQYLPLSAEDNLG
PLPENWEMAYTENGEVYFIDHNAKTTSWLDPRCLNKQQKPLEECEDDEGVHTEELDSELE
LPAGWEKIEDPVYGVYYVDHINRKTQYENPVLEAKRKRQLEQQQQQQQHQQQPQQPQPPQ
PEEWTEDHASVVPPVAPSHPPSNPEPAREAPLQGKPFFTRNPSELEGKFIHTKLRKSSRG
FGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQS
IPIGASVDLELCRGYPLPFDPDDPNTSLVTSVAILDKEPIIVNGQETYDSPASHSSKTGK
VSNMKDARPSSPADVASNSSHGYPNDTVSLASSIATQPELITVHIVKGPMGFGFTIADSP
GGGGQRVKQIVDSPRCRGLKEGDLIVEVNKRNVQALTHNQVVDMLIECPKGSEVTLLVQR
GGLPVPKKSPKSQPLERKDSQNSSQHSVSSLRSLHTASPSHSAQVLPEYPPADVPAPDQT
DSSGQKKPDPFKIWAQSRSMYEDRPMSPSPASGLSKGERDREINSTNFGECQIPDYQEQD
IFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELICVDGTPVIGKSH
QLVVQLMQQAAKQGHVNLTVRRKVVFTVPKAENEVPSPASSHHSSNQPASLTEEKRTPQG
SQNSLNTVSSGSGSTSGIGSGGGGGSGVVSAVLQPYDVEIRRGENEGFGFVIVSSVSRPE
AGTTFAGNACVAMPHKIGRIIEGSPADRCGKLKVGDRILAVNGCSITNKSHSDIVNLIKE
AGNTVTLRIIPGDESSNATLLTNAEKIATITTTHAPSQQGTQETRTTTKPKPDSQFEFKG
PQATQEQDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDGPAERCGKMRIGDEILE
INGETTKNMKHSRAIELIKNGGRRVRLFLRRGDGSVPEYGGSNYENIPSFPGMTP
NT seq 3768 nt   +upstreamnt  +downstreamnt
atgtcgaaagtgatccagaagaagaaccactggactggccgcgttcacgaatgcaccgtg
aagcggggaccccagggcgagctgggggtgacggtgctggggggcgcggagcatggggag
tttccgtacgtgggggcggtggcggcggccgaggcggcggggcttcccggcggtggcgag
gggccgaagctggctgaaggtgagctgctgctggaggtgcagggggtccgggtgtccggc
ttgccccgctatgacgtgctgggagtcatcgacagctgcaaggaggccgtcaccttcaaa
gccgtcagacaaggaggaaggctcaacaaggacctacgacatttcctcaaccaacggttc
cagaaggggtctccagatcatgagctccagcagaccataagggacaacctctaccgccat
gctgtgccttgcacaacccggtctcccagagaaggagaagtgcctggcgtcgattacagc
tttctgactgtgaaggagttcctggacctcgagcagagtgggaccctgttggaagtcggc
acctatgaaggaaactattatgggacacccaaacctcccagccagccagtcagtgggaaa
gtgatcacgacggatgccttgcacagcctgcagtctggctccaaacagtcgacccctaag
cgaacaaaatcctacaatgatatgcaaaatgctggcatagtccacacggagaatgaggaa
gaggaggatgttcctgaaatgaacagtagcttcacagccgactctggagaccaggacgag
cccactctccaagaagcgacgctcccgcctgtgaatagtagcgcccttgctgctcccatc
acggacccttctcagaagttccctcagtacctacctctttctgcagaggataatttaggt
cctctacctgaaaactgggagatggcctatactgaaaatggagaagtctattttatagac
cacaacgcgaaaacaacatcatggttagaccctcggtgcctgaacaaacagcagaagcct
ctggaagaatgtgaagatgatgaaggggtacacaccgaggagctggacagtgaactagag
ctgcctgctggctgggaaaagattgaagaccctgtctacggtgtctactatgtagaccac
atcaacaggaagacgcaatatgaaaacccagtcctagaagccaaaaggaagagacagctt
gaacaacagcagcagcagcagcagcaccagcagcagccgcagcagcctcagccaccgcag
ccagaagagtggacagaagatcatgcatctgttgtgcctcctgttgctccttcccatccc
ccaagcaacccggagccagccagggaagctccacttcagggcaaacctttttttacaaga
aacccttctgagctggaaggcaagttcattcacacaaagctacggaaaagcagtcgaggc
tttggcttcacggtggttggaggggacgaacctgatgagttcctgcagatcaagagcctt
gtcctagatggtcctgctgcactggatggcaagatggagacaggagatgtaatcgtcagt
gtgaatgacacctgtgttttgggacacacacatgctcaagttgtgaaaattttccagtcc
attcccattggtgccagtgtggaccttgaactctgcagaggttatccattgccttttgac
ccggatgaccctaacacaagtttagtgacctcggtggccattttggacaaagaaccaata
attgtaaacggacaagagacctatgattcaccagcaagccacagtagtaaaacgggcaaa
gtcagcaacatgaaggatgccaggccaagcagccccgcagacgtggcttccaacagttct
catgggtatcccaacgacacagtctccttggcttcctccatagccacccagccagagcta
ataaccgttcacatagtcaaagggccaatgggatttggctttacgatcgcagatagtccc
ggtgggggtggccaaagagtgaagcagattgttgacagtccgcgctgcagaggcctcaaa
gaaggggatctgattgtggaggtgaataagaggaacgtgcaggccctgacgcacaatcaa
gtcgtggatatgctgattgagtgtccaaagggaagtgaggtcacactgttggtgcagcga
ggagggctaccagttcccaagaagagtccaaagtcgcagccactggagaggaaagacagc
cagaacagctcccagcacagtgtgtccagcctccggagcctgcacacagcttccccgagc
cacagtgcacaggtgctccctgagtacccacctgcagacgtccctgctccagatcagacc
gacagctctgggcagaaaaagccagatccctttaaaatctgggcccagtcgaggagcatg
tatgaagaccgacctatgtcaccttcgcctgcgtcaggactgagcaagggtgaaagagac
agagagatcaattccacgaattttggagaatgtcagattccagattaccaggagcaggac
atcttcctctggagaaaagagaccggttttggatttaggattctgggtggaaatgagcca
ggggaacccatttatatcggtcacatcgtaccactgggtgctgctgacacagacggccgc
ctgaggtctggagatgaattaatctgtgtggatgggacaccagtaattgggaaatcacac
cagctcgtggtccagcttatgcaacaagctgccaagcaaggccacgtcaatctcacagtg
aggcgtaaagtggtgtttacggtccccaaagcagagaacgaggtgccctcaccagcctca
tcgcaccacagtagcaaccagccagcgtccctgacggaagagaagcgcacaccgcagggc
agccagaactcgctgaacaccgtgagctcaggcagcggcagcaccagcggcattggcagt
ggtggtggcggaggcagcggcgtggtgagcgctgtgctgcagccatatgatgtggagatt
cggcgtggggagaacgagggctttgggtttgtcatcgtgtcctccgtgagcaggcccgaa
gcgggcaccaccttcgcaggcaatgcatgtgtggctatgcctcacaaaataggtcggatt
attgaggggagccctgctgaccgctgtggcaagctgaaagtaggagaccggatcttggcg
gtaaatggatgttccatcaccaacaaatcccattctgacattgtcaacctaatcaaagaa
gcaggcaacacagtgactctccgcatcatccccggggatgagtcctccaatgccacactg
ctgactaatgcggagaagattgccaccatcaccaccactcatgccccctcacaacagggg
acccaggaaacaaggaccaccaccaaaccaaagccggattctcagtttgagttcaaagga
ccgcaggctacacaggagcaagatttttacactgtggaattggaaagaggagccaaggga
tttggctttagtcttcgaggagggcgagagtataacatggacctttatgttctgcgctta
gcagaggatggtcctgcagaaagatgcggaaagatgaggattggcgatgaaattctagag
atcaatggtgagaccaccaaaaacatgaaacactctcgggccatagaactgatcaagaat
ggcggccgcagagtccgtctgtttctgaggcggggagacggctcggtcccagaatatggt
gggtcaaactatgaaaacatcccttccttccctggcatgactccatga

DBGET integrated database retrieval system