KEGG   Rattus norvegicus (rat): 113976Help
Entry
113976            CDS       T01003                                 

Gene name
Acsl4, Acs4, Facl4
Definition
(RefSeq) acyl-CoA synthetase long-chain family member 4
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00061  Fatty acid biosynthesis
rno00071  Fatty acid degradation
rno01100  Metabolic pathways
rno01212  Fatty acid metabolism
rno03320  PPAR signaling pathway
rno04146  Peroxisome
rno04216  Ferroptosis
rno04714  Thermogenesis
rno04920  Adipocytokine signaling pathway
Module
rno_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    113976 (Acsl4)
   00071 Fatty acid degradation
    113976 (Acsl4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    113976 (Acsl4)
  09143 Cell growth and death
   04216 Ferroptosis
    113976 (Acsl4)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113976 (Acsl4)
   03320 PPAR signaling pathway
    113976 (Acsl4)
  09159 Environmental adaptation
   04714 Thermogenesis
    113976 (Acsl4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    113976 (Acsl4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    113976 (Acsl4)
Enzymes [BR:rno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     113976 (Acsl4)
Lipid biosynthesis proteins [BR:rno01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   113976 (Acsl4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   113976 (Acsl4)
  Exosomal proteins of breast cancer cells
   113976 (Acsl4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 113976
NCBI-ProteinID: NP_446075
RGD: 69401
Ensembl: ENSRNOG00000019180
UniProt: O35547
Position
Xq33
AA seq 670 aa AA seqDB search
MAKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVAKFGKKDSLGTREI
LSEENEMQPNGKVFKKLILGNYKWINYLEVNCRVNNFGSGLTALGLKPKNTIAIFCETRA
EWMIAAQTCFKYNFPLVTLYATLGKEAVVHGLNESEASYLITSVELLESKLKAALLDINC
VKHIIYVDNKTINRAEYPEGLEIHSMQSVEELGSKPENSSIPPSRPTPSDMAIVMYTSGS
TGRPKGVMMHHSNLIAGMTGQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIG
YSSPLTLSDQSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFK
IGYDYKLEQIKKGYDAPLCNLILFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCP
IGQGYGLTESCGAGTVTEVTDYTTGRVGAPLICCEIKLKDWQEGGYTVHDKPNPRGEIVI
GGQNISMGYFKNEEKTAEDYSVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGE
YVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKKLTLLAQQKGVEGSWVDICN
NPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYL
KDIERMYGGK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagaataaaagctaagcccacttcagacaaacccggaagtccatatcgctct
gtcacgcacttcgactcactagctgtcatagacatccctggagcagatactctggataaa
ttatttgaccatgctgtagccaagtttgggaagaaggacagcctggggacccgggagatc
ctgagcgaagaaaatgaaatgcagccaaatggaaaggtttttaagaagttaattcttggg
aattataaatggataaactatcttgaagtgaactgccgagtgaataactttggaagtggc
ctcactgcactgggactgaaaccaaagaacaccattgccattttctgtgagaccagggcg
gagtggatgattgcagcgcagacctgctttaagtacaactttccgcttgtgactttatat
gctacccttggcaaagaagctgtcgttcatggattaaatgagtctgaggcttcctatctg
attactagtgttgaacttctggaaagcaaactgaaggcggcattattagatatcaattgt
gttaaacatatcatttatgtggataacaagactatcaatagagcggagtaccccgagggg
cttgagattcacagcatgcagtcagtagaggagctgggatccaagccagaaaactcaagc
attcctccaagtagaccaactccttcggacatggccattgtcatgtacaccagtggctct
actggccgccccaagggagtgatgatgcaccatagcaatctgatagctgggatgacaggc
cagtgtgagcgcatacctggattaggaccaaaggacacatatattggctacttacctttg
gctcatgtgctggaactgacagcagagatctcctgctttacctacggctgtaggattgga
tattcgtcaccactcacactgtctgaccagtccagcaaaatcaagaagggaagcaagggt
gattgtactgtactgaaacctacacttatggcggccgttccggaaatcatggatagaatt
tacaagaatgttatgagcaaggttcaagagatgaattatattcagaagactctatttaaa
attgggtatgattataaattagagcaaatcaagaaaggatatgatgcccctctttgtaat
ctgatactgtttaagaaggtgaaggctcttctaggaggaaatgtccgcatgatgctgtcc
ggcggtgccccactgtccccccagacacaccgattcatgaatgtctgcttctgctgcccc
attggtcagggctatgggctgacagaatcatgcggtgctggaacagttactgaagttacc
gactacactactggaagagttggcgctcctcttatttgctgtgaaattaaactgaaggac
tggcaggaaggtggttatacagttcatgataagccaaaccccagaggtgaaattgtgatt
ggaggccagaatatctccatgggatattttaaaaatgaagagaaaacagcagaagattat
tctgtggatgaaaatggacaaaggtggttttgcactggtgatattggagaattccaccct
gatggatgcttacagattatcgatcgtaagaaagatctggtgaagctgcaagccggagag
tacgtgtctcttgggaaagtcgaagccgcactgaagaattgtccactgatcgacaacatc
tgtgcttttgccaaaagtgaccagtcttatgtgatcagttttgtggttcccaaccagaaa
aagttgactcttttggcacaacagaagggggtagaaggatcttgggttgatatttgcaat
aatcctgccatggaagctgaaatactgaaagaaattcgagaagctgcaaatgccatgaaa
ttggaacgatttgaaattccaatcaaagttcgattgagcccagagccatggacccctgaa
actggtttggtaacagatgccttcaagctgaaaaggaaggaactgaagaaccattatctt
aaagacattgagcggatgtatgggggcaaataa

DBGET integrated database retrieval system