KEGG   Rattus norvegicus (rat): 113984
Entry
113984            CDS       T01003                                 

Gene name
Nr2f2, Tfcoup2
Definition
(RefSeq) nuclear receptor subfamily 2, group F, member 2
  KO
K08548  COUP transcription factor 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    113984 (Nr2f2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    113984 (Nr2f2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    113984 (Nr2f2)
Nuclear receptors [BR:rno03310]
 2. Hepatocyte nuclear factor 4 like
  2F. COUP-TF like receptor
   113984 (Nr2f2)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 113984
NCBI-ProteinID: NP_542956
RGD: 69305
Ensembl: ENSRNOG00000010308
UniProt: O09018
Position
1q31
AA seq 414 aa
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGSQ
GGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN
CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSG
YISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD
QVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE
KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF
GKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggcaatggtagtcagcacgtggcgcgacccccaggacgaggtgcccggctctcagggc
agccaggcctcgcaggcgccgcccgtgccgggcccgccgcctggcgccccgcacacgcca
cagacgccgggccaagggggcccggccagcacgccggcccagacagcggctggcagccag
ggcggccctggcggcccaggcagcgacaaacagcagcagcagcagcacatcgagtgcgtg
gtgtgcggggacaagtcgagcggcaagcactacggccagttcacgtgcgagggctgcaag
agcttcttcaagcgcagcgtgcggaggaacctgagctacacgtgccgcgccaaccggaac
tgtcccatcgaccagcaccaccgcaaccagtgccagtactgccgcctcaaaaagtgcctc
aaagtgggcatgagacgggaagctgtacagaggggcaggatgccgcccacccagcctact
cacgggcagtttgcactgaccaacggggaccccctcaactgccactcgtacctgtccgga
tatatttccctgctgctgcgcgcggagccctaccccacgtcgcgcttcggcagtcagtgc
atgcagcctaacaacatcatgggcatcgagaacatttgcgaactggccgcacggatgctc
ttcagcgccgttgagtgggcccggaacatccccttcttccctgacctgcagatcacggac
caggtggccctccttcgcctcacctggagcgagctgttcgtgttgaatgcagcacagtgc
tccatgcccctccatgttgccccgctccttgccgctgctggcctgcacgcttcacccatg
tcagccgaccgggtggtcgcctttatggaccacatacggatcttccaagagcaagtggag
aagctcaaggcactgcacgtcgactccgccgagtacagctgcctcaaggccatagtcctg
ttcacctcagatgcctgtggtctgtctgatgtagcccacgtggaaagtttgcaggaaaag
tcccagtgtgctttggaagagtacgttaggagccagtaccccaaccagccaacacggttc
ggaaagcttttgcttcgtctcccttccctccgcacggtctcctcctcagtcatagagcaa
ttgtttttcgtccgtttggtaggtaaaacccccatcgaaaccctcatccgggatatgtta
ctgtccggcagcagttttaactggccatacatggcaattcaataa

DBGET integrated database retrieval system