KEGG   Rattus norvegicus (rat): 113992
Entry
113992            CDS       T01003                                 

Gene name
Ugt1a6
Definition
(RefSeq) UDP-glucuronosyltransferase 1-6 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    113992 (Ugt1a6)
   00053 Ascorbate and aldarate metabolism
    113992 (Ugt1a6)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    113992 (Ugt1a6)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113992 (Ugt1a6)
   00860 Porphyrin and chlorophyll metabolism
    113992 (Ugt1a6)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113992 (Ugt1a6)
   00982 Drug metabolism - cytochrome P450
    113992 (Ugt1a6)
   00983 Drug metabolism - other enzymes
    113992 (Ugt1a6)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    113992 (Ugt1a6)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    113992 (Ugt1a6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    113992 (Ugt1a6)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     113992 (Ugt1a6)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   113992 (Ugt1a6)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Pox_A14
Other DBs
NCBI-GeneID: 113992
NCBI-ProteinID: NP_001034780
RGD: 620949
Ensembl: ENSRNOG00000018740
UniProt: P08430 Q63662 Q6T5E9
Position
9
AA seq 530 aa
MACLLPAARLPAGFLFLVLWGSVLGDKLLVVPQDGSHWLSMKEIVEHLSERGHDIVVLVP
EVNLLLGESKYYRRKSFPVPYNLEELRTRYRSFGNNHFAASSPLMAPLREYRNNMIVIDM
CFFSCQSLLKDSATLSFLRENQFDALFTDPAMPCGVILAEYLKLPSVYLFRGFPCSLEHM
LGQSPSPVSYVPRFYTKFSDHMTFPQRLANFIANILENYLYHCLYSKYEILASDLLKRDV
SLPALHQNSLWLLRYDFVFEYPRPVMPNMIFIGGTNCKKKGNLSQEFEAYVNASGEHGIV
VFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGH
PKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDL
ENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggcttgccttcttcctgctgctcgacttcctgcaggctttctcttcttagtgctctgg
ggctcagttctaggtgacaagctgctggtggtcccccaggatggcagccactggcttagc
atgaaggagatagtggagcacctcagtgaacgcggacacgacattgtggtgctagtgcca
gaagtcaatttgcttttgggagaatccaaatactacaggaggaaaagcttcccggtcccc
tacaacctagaagagttgcggacccgctatcgctcctttgggaacaaccactttgctgcc
agttcccccctgatggctcctctaagagagtacaggaacaacatgattgtcattgacatg
tgctttttcagctgccagagcctcctgaaggactcggccaccctcagcttcctcagggag
aaccagtttgatgctctgttcacagacccggccatgccctgtggtgtgatcctggctgag
tatctcaagctgccttccgtctacctcttcagaggtttcccatgctctctggagcacatg
cttggtcaaagcccaagccccgtatcctatgttcccagattctacaccaaattctcagac
cacatgacatttccccaacggctggccaacttcattgctaacatcttggagaactacctt
tatcattgtctgtactcaaagtatgagatccttgcctcagacctcctcaagagagatgtg
tccctacctgccttacaccagaactctctgtggctgttacggtatgattttgtgttcgaa
tacccccggccagtcatgcccaacatgatcttcattggagggaccaactgcaagaagaag
gggaacctgtctcaggaatttgaagcctatgtcaacgcctccggagaacatggcatcgtg
gttttctctttgggatccatggtctcagagattccagagaagaaagcgatggaaattgct
gaggctttgggcagaattcctcagacggtcctgtggcgctacaccggaactagaccatcg
aaccttgcaaagaacactattcttgtcaaatggctaccccaaaacgatctgcttggtcat
ccaaaggctcgggcgttcatcacacactccggttcccatggtatttatgaaggaatatgc
aatggggttccaatggtgatgatgcccttgtttggtgatcagatggacaacgccaagcgc
atggaaactcggggagctggggtgaccctgaatgtcctggaaatgactgccgatgatttg
gaaaacgcccttaaaactgtcatcaataacaagagttacaaggagaacatcatgcgcctc
tccagccttcacaaggaccgtcctatcgagcctctggacctggctgtgttctgggtggag
tacgtgatgaggcacaagggggcgccacacctgcgccccgccgcccacgacctcacctgg
taccagtaccactccttggacgtgattggctttctcctggccatcgtgttgacggtggtc
ttcattgtctataaaagttgtgcctatggctgccggaaatgctttgggggaaagggtcga
gtgaagaaatcacacaaatccaagacccactga

KEGG   Rattus norvegicus (rat): 154516
Entry
154516            CDS       T01003                                 

Gene name
Ugt1a7c
Definition
(RefSeq) UDP-glucuronosyltransferase 1A7 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    154516 (Ugt1a7c)
   00053 Ascorbate and aldarate metabolism
    154516 (Ugt1a7c)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    154516 (Ugt1a7c)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    154516 (Ugt1a7c)
   00860 Porphyrin and chlorophyll metabolism
    154516 (Ugt1a7c)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    154516 (Ugt1a7c)
   00982 Drug metabolism - cytochrome P450
    154516 (Ugt1a7c)
   00983 Drug metabolism - other enzymes
    154516 (Ugt1a7c)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    154516 (Ugt1a7c)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    154516 (Ugt1a7c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    154516 (Ugt1a7c)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     154516 (Ugt1a7c)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   154516 (Ugt1a7c)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C AMPK1_CBM Pox_A14
Other DBs
NCBI-GeneID: 154516
NCBI-ProteinID: NP_569091
RGD: 620950
Ensembl: ENSRNOG00000018740
UniProt: Q6T5E8 Q68G32
Position
9
AA seq 531 aa
MAPADIPASLPLGLCLLLASGFGHAGKLLVVPMDGSHWFTMQMVVEKLLPKGHEVVVVVP
EVSWQLGKPLNFTVKTYSVSHTQEDLNREFKFFIDSQWKTQQEGGVLPLLTSPAQGFFEL
LFSHCRSLFKDKKLVEYLKQSSFDAVFLDPFDVCGLTVAKYFSLPSVVFSRGIFCHYLEE
GSQCPSPPSYVPRGILKLTDTMTFKERVWNLLSYMGEHAFCPSFFKTATDIASEVLQTPV
TMTDLFSPVSVWLLRTDFTLELPRPVMPNVIHIGGINCHQRKPLSKEFEAYVNASGEHGI
VVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLG
HPKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADD
LENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLT
WYQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggctcctgcagacattccagcctctcttcctctcggtctgtgcctgctgctggcctct
ggctttgggcatgcaggcaagctgctggtggtgcccatggatggcagccactggttcacc
atgcagatggttgtggagaagctccttcccaaaggccatgaggtggtggtggttgttcca
gaggtcagttggcagctgggaaaaccactgaattttacggtgaaaacgtattcagtttct
cacactcaggaggatttaaatcgggagttcaagttttttattgactctcagtggaaaact
caacaagagggcggagttcttcctctactgactagccctgcccagggtttcttcgaatta
ctgttttcacactgtaggagtttgtttaaggacaagaagttagtggagtacttgaagcag
agttcgtttgatgctgtgtttctggatccttttgatgtgtgtggcttaactgttgccaag
tacttttctctcccgtcagtggtcttcagcagggggatattttgtcactatcttgaagaa
ggctcccagtgccccagtcctccttcatatgtccccagaggtatcttgaaactcacagat
accatgactttcaaggaaagagtgtggaaccttctttcctacatgggggagcatgcattc
tgtcccagttttttcaaaactgctaccgacattgcctctgaagttctccagaccccggtg
actatgacagacctcttcagcccagtgtccgtttggttgttacgcacagacttcacgttg
gaattacccagacctgtgatgcccaatgtgatccacattggagggatcaactgccaccaa
aggaagccactttccaaggaatttgaagcctatgtcaacgcctccggagaacatggcatc
gtggttttctctttgggatccatggtctcagagattccagagaagaaagcgatggaaatt
gctgaggctttgggcagaattcctcagacggtcctgtggcgctacaccggaactagacca
tcgaaccttgcaaagaacactattcttgtcaaatggctaccccaaaacgatctgcttggt
catccaaaggctcgggcgttcatcacacactccggttcccatggtatttatgaaggaata
tgcaatggggttccaatggtgatgatgcccttgtttggtgatcagatggacaacgccaag
cgcatggaaactcggggagctggggtgaccctgaatgtcctggaaatgactgccgatgat
ttggaaaacgcccttaaaactgtcatcaataacaagagttacaaggagaacatcatgcgc
ctctccagccttcacaaggaccgtcctatcgagcctctggacctggctgtgttctgggtg
gagtacgtgatgaggcacaagggggcgccacacctgcgccccgccgcccacgacctcacc
tggtaccagtaccactccttggacgtgattggctttctcctggccatcgtgttgacggtg
gtcttcattgtctataaaagttgtgcctatggctgccggaaatgctttgggggaaagggt
cgagtgaagaaatcacacaaatccaagacccactga

KEGG   Rattus norvegicus (rat): 24861
Entry
24861             CDS       T01003                                 

Gene name
Ugt1a1
Definition
(RefSeq) UDP-glucuronosyltransferase 1A1 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    24861 (Ugt1a1)
   00053 Ascorbate and aldarate metabolism
    24861 (Ugt1a1)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    24861 (Ugt1a1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    24861 (Ugt1a1)
   00860 Porphyrin and chlorophyll metabolism
    24861 (Ugt1a1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24861 (Ugt1a1)
   00982 Drug metabolism - cytochrome P450
    24861 (Ugt1a1)
   00983 Drug metabolism - other enzymes
    24861 (Ugt1a1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    24861 (Ugt1a1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    24861 (Ugt1a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    24861 (Ugt1a1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     24861 (Ugt1a1)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   24861 (Ugt1a1)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Pox_A14 Glyco_transf_4
Other DBs
NCBI-GeneID: 24861
NCBI-ProteinID: NP_036815
RGD: 3935
Ensembl: ENSRNOG00000018740
UniProt: Q64550 Q5DT04
Position
9
AA seq 535 aa
MSVVCRSSCSLLLLPCLLLCVLGPSASHAGKLLVIPIDGSHWLSMLGVIQQLQQKGHEVV
VIAPEASIHIKEGSFYTMRKYPVPFQNENVTAAFVELGRSVFDQDPFLLRVVKTYNKVKR
DSSMLLSGCSHLLHNAEFMASLEQSHFDALLTDPFLPCGSIVAQYLSLPAVYFLNALPCS
LDLEATQCPAPLSYVPKSLSSNTDRMNFLQRVKNMIIALTENFLCRVVYSPYGSLATEIL
QKEVTVKDLLSPASIWLMRNDFVKDYPRPIMPNMVFIGGINCLQKKALSQEFEAYVNASG
EHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQN
DLLGHPKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEM
TADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAA
HDLTWYQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgtccgtggtgtgccggagctcatgttcgcttctgcttcttccgtgccttctgctgtgt
gtgttgggtccctctgcgtcccatgctgggaagctgttagtgatccccatagatggcagc
cactggctgagtatgctcggagttattcagcagctccagcaaaaggggcacgaagtggtg
gtcatagcacctgaagcttcgatacacataaaagaaggatcattttacactatgaggaag
taccctgtgccattccaaaatgaaaacgtgacagctgcttttgtggaacttgggcggagt
gtctttgatcaagatccttttctgctgcgtgtggttaaaacatacaacaaagtcaaaagg
gactccagtatgctgctgtctggctgctcccaccttctgcacaatgccgagtttatggcc
tctctggaacaaagccactttgatgctctgctgacagaccctttccttccgtgtggctcc
attgtggcccagtacctgtctctgcctgctgtgtacttcttgaatgcattgccatgcagc
ctggatttggaagccacccaatgccctgctccgttgtcctacgtgcccaagagtttgtcc
tcgaacacagatcgcatgaacttcctgcagcgggtgaagaacatgattattgctttgaca
gagaactttctatgcagagtggtttactccccctatgggtcacttgccactgaaatctta
cagaaagaggtgactgtcaaggaccttctgagtcctgcatctatctggctgatgagaaac
gactttgtgaaagattaccccaggcccatcatgcccaacatggtttttattggtgggata
aactgccttcagaaaaaagccctatcccaggaatttgaagcctatgtcaacgcctccgga
gaacatggcatcgtggttttctctttgggatccatggtctcagagattccagagaagaaa
gcgatggaaattgctgaggctttgggcagaattcctcagacggtcctgtggcgctacacc
ggaactagaccatcgaaccttgcaaagaacactattcttgtcaaatggctaccccaaaac
gatctgcttggtcatccaaaggctcgggcgttcatcacacactccggttcccatggtatt
tatgaaggaatatgcaatggggttccaatggtgatgatgcccttgtttggtgatcagatg
gacaacgccaagcgcatggaaactcggggagctggggtgaccctgaatgtcctggaaatg
actgccgatgatttggaaaacgcccttaaaactgtcatcaataacaagagttacaaggag
aacatcatgcgcctctccagccttcacaaggaccgtcctatcgagcctctggacctggct
gtgttctgggtggagtacgtgatgaggcacaagggggcgccacacctgcgccccgccgcc
cacgacctcacctggtaccagtaccactccttggacgtgattggctttctcctggccatc
gtgttgacggtggtcttcattgtctataaaagttgtgcctatggctgccggaaatgcttt
gggggaaagggtcgagtgaagaaatcacacaaatccaagacccactga

KEGG   Rattus norvegicus (rat): 24862
Entry
24862             CDS       T01003                                 

Gene name
Ugt2b
Definition
(RefSeq) UDP-glucuronosyltransferase 2B2 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    24862 (Ugt2b)
   00053 Ascorbate and aldarate metabolism
    24862 (Ugt2b)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    24862 (Ugt2b)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    24862 (Ugt2b)
   00860 Porphyrin and chlorophyll metabolism
    24862 (Ugt2b)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24862 (Ugt2b)
   00982 Drug metabolism - cytochrome P450
    24862 (Ugt2b)
   00983 Drug metabolism - other enzymes
    24862 (Ugt2b)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    24862 (Ugt2b)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    24862 (Ugt2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    24862 (Ugt2b)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     24862 (Ugt2b)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   24862 (Ugt2b)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C
Other DBs
NCBI-GeneID: 24862
NCBI-ProteinID: NP_113721
RGD: 3936
UniProt: F1LM22
Position
14
AA seq 530 aa
MPRKWISALFLLQISYCFKSGHCGKVLVWPMDFSHWMNIKIILDELVQRGHEVTVLKPSA
YFFLDPKKSSDLKFEIFPTSISKDELQNHFIKLLDVWTYELPRDTCLSYSPILQNLVYEF
SYFYLSICKDAVSNKQLMTKLQESKFDVLFADPVASCGDLIAELLHIPFLYSLSFSPGHK
LEKSIGKFILPPSYVPVILSGLAGKMTFIDRVKNMICMLYFDFWFERLRHKEWDTFYSEI
LGRPTTVDETMSKVEIWLIRSYWDLKFPHPTLPNVDYIGGLHCKPAKPLPKDMEEFVQSS
GEHGVVVFSLGSMVSNMTEEKANAIAWALAQIPQKVLWKFDGKTPATLGPNTRVYKWLPQ
NDILGHPKTKAFVTHGGANGLYEAIYHGIPMIGIPLFGDQPDNIAHMVAKGAAVSLNIRT
MSKLDFLSALEEVIDNPFYKKNVMLLSTIHHDQPMKPLDRAVFWIEFIMRHKGAKHLRPL
GHNLPWYQYHSLDVIGFLLTCFAVIAALTVKCLLFMYRFFVKKEKKMKNE
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgcccagaaagtggatttctgctctgttcctgctacagataagttactgtttcaaatct
gggcactgtgggaaggtgttggtgtggccgatggactttagtcactggatgaatataaaa
ataatccttgatgaacttgtacagaggggccatgaggtcactgttctgaaaccttcggct
tacttttttcttgatccgaaaaaatcgtctgaccttaagtttgaaatttttcctacatct
atcagtaaagatgagctgcaaaatcatttcataaaacttttggatgtgtggacttatgag
ttgccaagagatacatgtttgtcatattctcctatccttcaaaatctagtttatgaattt
tcttatttttatctaagtatttgtaaagacgctgtttcaaacaagcagctcatgacaaaa
ctacaggaatccaagtttgatgttcttttcgcagatcctgtggcttcctgtggggatctg
atagctgaactgctccacattccttttctgtacagtcttagcttctctccaggccacaaa
cttgaaaagtccattggaaaatttatactccctccatcttatgtgcctgtaattttgtcg
ggactggctggcaaaatgacattcatagacagggtaaaaaatatgatatgtatgctttat
ttcgacttttggttcgagagacttagacacaaggaatgggacacattttacagtgagatt
ttgggaaggcccaccaccgtagatgagacaatgagcaaagtagaaatatggcttattaga
tcctattgggatttgaaatttccccacccaacattaccaaatgttgactatattggagga
ctccattgcaaacctgctaaacccttgcctaaggatatggaagaatttgtccagagctct
ggagagcacggtgtggtggtgttttctctggggtcaatggtcagcaacatgacagaagaa
aaggccaacgcaattgcatgggcccttgcccagattccacaaaaggttctttggaaattt
gatggcaaaaccccagcaacattaggacccaataccagagtctacaagtggctcccgcag
aatgacatcctgggtcacccaaaaaccaaagcctttgtaactcatggtggagccaatggc
ctctatgaggcaatctatcatggaatccctatgattggcattcctctgtttggagatcaa
cctgataatattgcccacatggtggccaaaggagcagctgtttcattgaatatcaggaca
atgtcaaagttagattttctcagtgcactggaggaagtcatagacaatccgttctataaa
aaaaatgttatgttgttgtcaaccattcaccatgaccagcctatgaagcccctggacaga
gctgtcttctggattgagtttatcatgcgccacaaaggggccaagcacctgagaccactt
ggacataaccttccctggtaccagtaccactctctggatgtgattggattcctgctcacc
tgttttgcagtcattgcagctcttactgtaaaatgtctcttgttcatgtaccgattcttt
gtaaagaaggaaaagaaaatgaagaatgagtag

KEGG   Rattus norvegicus (rat): 266685
Entry
266685            CDS       T01003                                 

Gene name
Ugt2b15
Definition
(RefSeq) UDP-glucuronosyltransferase 2B17 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    266685 (Ugt2b15)
   00053 Ascorbate and aldarate metabolism
    266685 (Ugt2b15)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    266685 (Ugt2b15)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    266685 (Ugt2b15)
   00860 Porphyrin and chlorophyll metabolism
    266685 (Ugt2b15)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    266685 (Ugt2b15)
   00982 Drug metabolism - cytochrome P450
    266685 (Ugt2b15)
   00983 Drug metabolism - other enzymes
    266685 (Ugt2b15)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    266685 (Ugt2b15)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    266685 (Ugt2b15)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    266685 (Ugt2b15)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     266685 (Ugt2b15)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   266685 (Ugt2b15)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-GeneID: 266685
NCBI-ProteinID: NP_695226
RGD: 628623
Ensembl: ENSRNOG00000046540
UniProt: P08542
Position
14
AA seq 530 aa
MPGKWISALLLLQISCCFQSGNCGKVLVWPMEFSHWMNIKTILDELVQRGHEVTVLKPSA
YYVLDPKKSPDLKFETFPTSVSKDELENYFIKLVDVWTYELQRDTCLSYSPLLQNMIDGF
SDYYLSLCKDTVSNKQLMAKLQESKFDVLLSDPVAACGELIAEVLHIPFLYSLRFSPGYK
IEKSSGRFILPPSYVPVILSGMGGPMTFIDRVKNMICTLYFDFWFHMFNAKKWDPFYSEI
LGRPTTLAETMGKAEMWLIRSYWDLEFPHPTLPNVDYIGGLQCRPPKPLPKDMEDFVQSS
GEHGVVVFSLGSMVSSMTEEKANAIAWALAQIPQKVLWKFDGKTPATLGPNTRVYKWLPQ
NDLLGHPKTKAFVTHGGANGVYEAIYHGIPMVGIPMFGEQHDNIAHMVAKGAAVTLNIRT
MSKSDLFNALKEIINNPFYKKNAVWLSTIHHDQPMKPLDKAVFWIEFVMRHKGAKHLRPL
GHNLPWYQYHSLDVIGFLLTCSAVIAVLTVKSFLFIYRLFVKKEKKMKNE
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgcctgggaagtggatttctgctcttctcctgctacagataagttgctgtttccaatct
gggaactgtgggaaggtgttggtgtggccgatggaattcagccactggatgaatataaaa
acaatactggatgaacttgtacagaggggccatgaagtcactgttctgaaaccttcggct
tactatgttcttgatccgaaaaaatcgccagatcttaagtttgaaactttccctacatct
gtcagtaaagatgaactggaaaattatttcataaagcttgtggatgtgtggacttatgag
ttgcaaagagatacatgtttgtcttattctcctttactacaaaatatgatagatggattt
tctgattactatctaagtctttgtaaagacaccgtttcaaacaagcagctcatggcaaaa
ctacaggaatccaagtttgatgttcttttgtcagatcctgtggctgcctgtggggagctg
atagccgaagtgctccacattccttttctgtacagtcttcgcttctctccaggctacaaa
attgaaaagtccagtggaagatttatattacctccatcttatgtaccagtaattttgtca
ggaatgggtggcccaatgacattcatagacagggtaaaaaatatgatatgtacgctttat
tttgacttttggttccatatgtttaatgccaagaaatgggatccattttacagtgagatt
ttgggaaggcccaccaccttagctgagacaatgggcaaagcagaaatgtggctcattaga
tcctactgggatttggaatttccccacccaacattaccaaatgttgactatattggagga
ctccaatgcagacctcctaaacccttgcccaaggatatggaagattttgtccagagctct
ggagagcatggcgtggtggtgttttctctggggtcaatggtcagcagcatgacagaagaa
aaggccaatgcaattgcatgggcccttgcccagattccacaaaaggttctttggaaattt
gatggcaaaaccccagcaaccttaggacccaataccagagtctacaagtggcttccccag
aatgacctccttggtcatccaaaaaccaaagcctttgtaactcatggtggagccaatggt
gtctatgaggccatctatcatggaatccctatggttggcattcctatgtttggagaacaa
catgataacattgcccacatggtggccaaaggagcagctgttacactgaatatcaggaca
atgtcaaagtcagatttgttcaatgcactaaaggaaataataaacaatccattctataaa
aaaaatgctgtgtggttgtcaaccattcaccatgaccaacctatgaagcccctggacaag
gctgtcttctggattgagtttgtcatgcgccacaaaggggccaagcacctgagaccactt
ggacataaccttccctggtaccagtaccactctctggatgtgattggattcctgctcacc
tgttcggcagtcattgcagtccttactgtaaaatccttcttgtttatttaccgactcttt
gtgaagaaggaaaagaaaatgaagaatgagtag

KEGG   Rattus norvegicus (rat): 286954
Entry
286954            CDS       T01003                                 

Gene name
Ugt2b17
Definition
(RefSeq) UDP-glucuronosyltransferase 2B1 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    286954 (Ugt2b17)
   00053 Ascorbate and aldarate metabolism
    286954 (Ugt2b17)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    286954 (Ugt2b17)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    286954 (Ugt2b17)
   00860 Porphyrin and chlorophyll metabolism
    286954 (Ugt2b17)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    286954 (Ugt2b17)
   00982 Drug metabolism - cytochrome P450
    286954 (Ugt2b17)
   00983 Drug metabolism - other enzymes
    286954 (Ugt2b17)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    286954 (Ugt2b17)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    286954 (Ugt2b17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    286954 (Ugt2b17)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     286954 (Ugt2b17)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   286954 (Ugt2b17)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Pro_3_hydrox_C
Other DBs
NCBI-GeneID: 286954
NCBI-ProteinID: NP_775417
RGD: 708541
Ensembl: ENSRNOG00000001990
Vega: OTTRNOG00000000152
UniProt: P09875
Position
14
AA seq 529 aa
MSMKQTSVFLLIQLICYFRPGACGKVLVWPTEYSHWINIKIILNELAQRGHEVTVLVSSA
SILIEPTKESSINFEIYSVPLSKSDLEYSFAKWIDEWTRDFETLSIWTYYSKMQKVFNEY
SDVVENLCKALIWNKSLMKKLQGSQFDVILADAVGPCGELLAELLKTPLVYSLRFCPGYR
CEKFSGGLPLPPSYVPVVLSELSDRMTFVERVKNMLQMLYFDFWFQPFKEKSWSQFYSDV
LGRPTTLTEMMGKADIWLIRTFWDLEFPHPFLPNFDFVGGLHCKPAKPLPREMEEFVQSS
GEHGVVVFSLGSMVKNLTEEKANVVASALAQIPQKVVWRFDGKKPDTLGSNTRLYKWIPQ
NDLLGHPKTKAFVAHGGTNGIYEAIYHGIPIVGIPLFADQPDNINHMVAKGAAVRVDFSI
LSTTGLLTALKIVMNDPSYKENAMRLSRIHHDQPVKPLDRAVFWIEYVMRHKGAKHLRST
LHDLSWFQYHSLDVIGFLLLCVVGVVFIITKFCLFCCRKTANMGKKKKE
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgtctatgaaacagacttcagtgtttctgttgatacagctcatatgctactttagacct
ggagcctgtggaaaagtgctagtgtggcccacagaatacagccactggattaatataaag
ataattctgaatgaacttgcccagagaggtcatgaagtcacggttcttgtatcttcggct
tccattctcattgagcctaccaaggaatcttctattaattttgagatttactctgtacct
ttgagtaaaagtgatcttgaatatagttttgcaaaatggatagatgaatggacacgtgat
tttgaaacactctcgatttggacatattattcaaaaatgcaaaaagtcttcaatgaatat
tctgatgtcgttgaaaatttatgcaaagcactcatttggaacaagagtcttatgaaaaaa
ctccaaggatctcaatttgatgtcattctcgcagatgctgtgggtccctgtggtgagctg
ctagcagaactgcttaagacacctttagtgtacagtctccgcttctgtcctggatacaga
tgtgaaaagttcagtgggggacttccactgcctccttcctatgtgcctgttgttctttca
gaattaagtgaccgcatgacatttgtggaaagagtgaagaatatgttgcagatgctgtat
tttgacttttggtttcaaccatttaaagagaagtcctggagtcagttttacagtgatgtt
ctaggtagacccacaacattaactgagatgatggggaaggcagatatatggctcattcga
accttctgggacttggaatttccacacccattcttacctaattttgactttgttggagga
ctccattgcaaaccagccaaaccactgcctagggaaatggaagaatttgttcagagctct
ggagaacatggtgtagtggtgttttctctgggatcaatggttaaaaacctgactgaagaa
aaagccaatgtagttgcttctgctcttgcccaaattccacagaaggttgtatggagattt
gatggtaagaaaccagataccttaggatctaacactcggctgtacaagtggatcccccag
aatgaccttcttggtcatccaaaaaccaaagcttttgtagctcatggtggaacaaatggc
atctatgaggcaatctaccatggcattcctattgttggtattcccttgtttgcagatcaa
ccggataacattaatcacatggtagccaaaggagctgctgttagagttgacttcagcata
ctgtcaactacaggccttctcactgccttgaagattgtcatgaatgacccttcctataag
gagaatgccatgagattatccagaatccaccatgatcagccagtgaagcccctggaccga
gccgtcttctggatcgagtatgtcatgcgtcacaaaggagccaagcacctccgctcaact
ctgcatgaccttagctggttccagtaccactctctggatgtcattgggttcctattgctc
tgtgtggtaggtgtggtattcatcatcacaaaattctgcctcttttgttgccgtaagact
gctaacatgggaaagaagaagaaagagtag

KEGG   Rattus norvegicus (rat): 286989
Entry
286989            CDS       T01003                                 

Gene name
Ugt2b7
Definition
(RefSeq) UDP-glucuronosyltransferase 2B7 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    286989 (Ugt2b7)
   00053 Ascorbate and aldarate metabolism
    286989 (Ugt2b7)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    286989 (Ugt2b7)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    286989 (Ugt2b7)
   00860 Porphyrin and chlorophyll metabolism
    286989 (Ugt2b7)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    286989 (Ugt2b7)
   00982 Drug metabolism - cytochrome P450
    286989 (Ugt2b7)
   00983 Drug metabolism - other enzymes
    286989 (Ugt2b7)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    286989 (Ugt2b7)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    286989 (Ugt2b7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    286989 (Ugt2b7)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     286989 (Ugt2b7)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   286989 (Ugt2b7)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Pro_3_hydrox_C
Other DBs
NCBI-GeneID: 286989
NCBI-ProteinID: NP_775445
RGD: 708417
UniProt: Q62789
Position
14
AA seq 529 aa
MPQKWISALLLLQISFCFRSGNCGKVLVWPLEYSHWMNLKIILDELVQRGHEVTVLRPSS
SVFLDPKKASGLVYETFPTTSNNDEVEKFFTQWVNTWTYDVPKYTCLRYYPSLNKMFGQF
SDLWLQLCREVVSNKHLMAKLKESQFDVVLSDAVGPCGELIAEILQLPFVYSLRFGIGYG
IEKYSAGQPFPPSYVPIILSGLSGQMTFMERVENMLCLLYFDFWFESFPAKDWDPFFSEI
LGRPTTMVDTMKKAEIWLIRSYWDLEFPRPSLPNIEFVGGLHCQPAKPLPKEMEDFAQSS
GEHGVVVFSLGSMIRNITQERANTIASALAQIPQKVFWRFEGKKPDTLGPNTRVFKWIPQ
NDLLGHPKTKAFVTHGGANGIYESIHHGIPMVGIPLFAEQRDNVAHMVAKGAAVSLDFHT
MSSSDLLNALKAVINKPSYKKKVMWLSAIHHDQPLKPLDRAVFWIEFVMRHKGAKHLRPL
AHNLAWYQYHSLDVIGFLLACVLAIVLLAVKCCLFLYRFFVKVAKNKRD
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgcctcagaagtggatttctgctctgctcctactgcagataagtttctgcttcagatct
gggaactgtgggaaagtgttggtgtggccattggaatacagtcactggatgaatttaaag
ataatactggatgaacttgtacagaggggacatgaagtcactgttctcagaccttcatct
tctgtctttcttgatcccaaaaaagcatctggtcttgtatatgaaacatttcctacaact
tccaataatgatgaagtagaaaagttttttacccagtgggtgaatacgtggacatatgat
gtgccaaaatatacatgtttgagatactacccatctttgaacaaaatgtttgggcaattt
tctgatttgtggttacagctttgtagagaagttgtttcaaacaaacaccttatggcaaaa
ctaaaggaatcccagtttgatgtggtcctttcagatgctgttggtccctgtggtgagctg
atagctgagatactgcagttaccatttgtgtacagtcttcgctttggtattggctatgga
atagaaaagtacagtgcgggacaacccttccctccctcttatgtacctattattttgtca
ggattaagtggtcaaatgacattcatggagagagtggaaaatatgctatgtttactttat
tttgatttttggttcgagtcatttcctgctaaggattgggatccatttttcagcgaaatt
ttaggaagacccactacaatggttgacacaatgaagaaagcagaaatatggctcattcgg
tcctactgggacttggagtttccccgcccatccttgccaaacattgagtttgttggagga
cttcactgccaacctgccaaaccattacctaaggaaatggaagactttgcacagagctca
ggagaacatggtgtggtggtgttttctctggggtcgatgatcaggaacataacacaagaa
agggctaacacaattgcatcagccctggcacaaattccacaaaaggttttttggagattt
gagggcaagaaaccagacaccttaggacccaatactcgggtgttcaagtggataccccag
aatgaccttcttggtcatccaaaaactaaggcttttgtaactcatggtggagccaatggc
atctatgagtcaatccatcatgggatccccatggttggcatccctttatttgcagaacaa
cgtgataacgttgctcacatggtagccaaaggagcagctgtttctctagattttcataca
atgtccagttcagatttgctcaacgcactgaaggcagtcatcaataaaccctcctataaa
aagaaagtgatgtggttgtcagccattcaccatgaccagcctctgaagcctctggacaga
gcagtcttctggattgagtttgtcatgcgtcacaaaggggccaagcatctgagaccactt
gcacataaccttgcctggtatcagtaccactctctggatgtgattggattcctgcttgcc
tgtgtgctggccattgttttacttgctgtaaaatgctgtctgtttctttaccgatttttt
gtaaaggtggcaaagaataaaagggactag

KEGG   Rattus norvegicus (rat): 289533
Entry
289533            CDS       T01003                                 

Gene name
Ugt2a3
Definition
(RefSeq) UDP-glucuronosyltransferase 2A3 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    289533 (Ugt2a3)
   00053 Ascorbate and aldarate metabolism
    289533 (Ugt2a3)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    289533 (Ugt2a3)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    289533 (Ugt2a3)
   00860 Porphyrin and chlorophyll metabolism
    289533 (Ugt2a3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    289533 (Ugt2a3)
   00982 Drug metabolism - cytochrome P450
    289533 (Ugt2a3)
   00983 Drug metabolism - other enzymes
    289533 (Ugt2a3)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    289533 (Ugt2a3)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    289533 (Ugt2a3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    289533 (Ugt2a3)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     289533 (Ugt2a3)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   289533 (Ugt2a3)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C S1FA
Other DBs
NCBI-GeneID: 289533
NCBI-ProteinID: NP_001129341
RGD: 1308444
Ensembl: ENSRNOG00000001973
Position
14
AA seq 534 aa
MVSVKWAVAIFLLQLCWSGCGICSKVLVWPCDMSHWLNLKTILEELAARGHEVTVLKYPS
IIIDQSKLTPLQFENIPVLYETEVAENHLNEIVNLAVNVIPNLSLWEAARTLQDFFLQLT
GNFEDLCRSTLYNQTLMNKLRDAKYDVMVLDPVIPCGELVAEVLQIPFVNTLRFSMGYSM
EKYCGQLPVPLSYVPVVMGELTDHMTFTERVKNMMLSLFFEFWLQQYDFAFWDQFYSKTL
GRPTTFCKTVGKAEIWLIRTYWDIEFPRPYLPNFEFVGGLHCKPAKPLPKELEEFVQSSG
EHGVVVFSLGSMIKNLTEEKANLIASALAQIPQKVLWRYSGKKPATLGPNTRILNWIPQN
DLLGHPKTRAFITHGGTNGIYEAIYHGVPMVGIPMFGDQPYNIAHMEAKGAAVKVAINTM
TSADLLSALRAVINEPSYKENAMRLSRVHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLSWFQYHSLDVIGFLLVCVVTLTFVITKCSLFMCRKCCLRERKKKGNRKKKN
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggtgtctgtaaaatgggctgtggcaatttttctgttgcagctttgctggagtggctgt
ggcatctgcagcaaggtccttgtgtggccctgtgatatgagccactggctgaatctcaag
actattcttgaggaactcgcagcaagagggcatgaggtgacagtcctgaaatatcccagt
attatcatagatcagagtaaacttactccactgcagttcgagaatatccctgtgctgtat
gaaactgaggttgccgagaatcatctaaatgaaattgtaaacctagctgtgaacgttatt
ccaaacctgtcactgtgggaagcagcaagaacacttcaagatttctttcttcagctgact
ggcaattttgaagatctctgtaggagtacattgtacaaccagacactcatgaacaagcta
cgggatgcaaaatatgatgtaatggttttggaccctgtcattccctgtggagagctggtg
gcagaagtacttcagatcccttttgtaaacacattgaggttcagcatgggctactccatg
gagaaatactgcggccaacttccagttccactttcgtatgtaccggttgtcatgggtgaa
ctaacagaccatatgacctttacagagagggtgaaaaatatgatgctttcactgtttttt
gagttttggctccagcaatatgactttgcattctgggatcagttttacagtaaaactcta
ggaagacccaccacattttgtaagactgtggggaaagctgaaatttggctaatccgaacg
tattgggatattgaatttcctcggccatatttaccaaattttgagtttgtgggaggactg
cactgcaaacctgccaagcctttgcctaaggaactggaggaatttgttcagagctctgga
gaacatggtgttgtagtgttttcgctggggtcaatgatcaaaaacctgacagaagagaaa
gccaatctcattgcatcagcccttgcccagattccccagaaggttttgtggagatactca
ggcaagaagccagccacattaggacccaatactcggattttaaattggattccccagaat
gatctgcttggacatcctaaaaccagggctttcatcacacatggtggaacgaacgggatc
tacgaagccatttaccacggggtccctatggtgggcattcccatgtttggtgatcagcct
tacaacatcgctcacatggaggccaagggagcagccgtgaaagtcgccatcaacacgatg
accagcgcagatttgctcagtgccttgagagcggtcattaatgagccttcctataaggag
aatgccatgcgattatcaagagtccaccacgatcagcctgtgaagcccctggacagagcc
gtcttctggattgagtttgtcatgcgtcacaaaggagccaagcaccttcgtgtggctgca
catgacctcagctggtttcagtaccactctctggatgtgatcgggttcctactggtctgt
gttgtaactctgacattcgtcatcactaaatgttctctgtttatgtgtagaaaatgttgt
ttgagagaaaggaagaaaaagggtaacagaaagaaaaagaactag

KEGG   Rattus norvegicus (rat): 29623
Entry
29623             CDS       T01003                                 

Gene name
Ugt2b37
Definition
(RefSeq) UDP-glucuronosyltransferase 2B37 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    29623 (Ugt2b37)
   00053 Ascorbate and aldarate metabolism
    29623 (Ugt2b37)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    29623 (Ugt2b37)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    29623 (Ugt2b37)
   00860 Porphyrin and chlorophyll metabolism
    29623 (Ugt2b37)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    29623 (Ugt2b37)
   00982 Drug metabolism - cytochrome P450
    29623 (Ugt2b37)
   00983 Drug metabolism - other enzymes
    29623 (Ugt2b37)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    29623 (Ugt2b37)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    29623 (Ugt2b37)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    29623 (Ugt2b37)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     29623 (Ugt2b37)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   29623 (Ugt2b37)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-GeneID: 29623
NCBI-ProteinID: NP_001007265
RGD: 3937
Ensembl: ENSRNOG00000046540
Vega: OTTRNOG00000000149
UniProt: F1M7N8
Position
14
AA seq 530 aa
MPGKWIFALLLLQISFCLRSAKCGKVLVWPMEFSHWMNIKTILDELVQRGHEVTVLKPSA
YYVLDPKKSPDLKFETFPTSVSKDELEKYFIKLVDAWTYELQRDTCLSFSPLLQNMMDEF
SDYYLSVCKDAVSNKQLMAKLQESKFDVLLSDPVAACGELIAEVLHIPFLYSLRASPGHK
IEKSSGRFILPPSYVPVILSGLGGQMTFIDRVKNMICMLYFDFWFHMFNAKNWDPFYTEI
LGRPTTLAETMGKAEMWLIRSYWDLEFPHPTLPNVDYIGGLQCKPAKPLPKDIEDFVQSS
GEHGVVVFSLGSMVSSMTEEKANAVAWALAQIPQKVLWKFDGKTPATLGPNTRVYKWLPQ
NDLLGHPKTKAFVTHGGANGVYEAIYHGIPMIGIPMFGEQHDNIAHMVAKGAAVTLNIRT
MSKSDLFNALKEVINNPFYKKNAMWLSTIHHDQPMKPLDKAIFWIEYVMRHKRAKHLRPL
GHNLPWYQYHSLDVIGFLLACLAVIAALAVKCFLFIYRFFAKKQKKMKNE
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgccaggaaaatggatttttgctcttctcttgctgcagataagtttctgcctcagatct
gcgaaatgtgggaaggtgttggtgtggccgatggaattcagtcactggatgaatataaaa
acaatactggatgaacttgtacagaggggccatgaagtcactgttctgaaaccttcagct
tactatgttcttgatccaaaaaaatcgccagaccttaagtttgaaacttttcctacatct
gtcagtaaagatgaactggaaaaatatttcataaaacttgtggatgcgtggacttatgag
ttgcaaagagatacatgtttgtctttttctcctttactacaaaatatgatggatgaattt
tctgattattatctaagtgtttgtaaagacgccgtttcaaacaagcagctcatggcaaaa
ctacaggaatccaagtttgatgttcttttatcagatcctgtggctgcctgtggggagctg
atagccgaagtgctccacattccttttctgtacagtcttcgtgcctctccaggccataaa
attgaaaagtccagtggaagatttatactacctccctcttatgtgcctgtaattttgtca
ggattgggtggccaaatgacattcatagacagggttaaaaatatgatatgtatgctttat
tttgacttttggttccatatgtttaatgccaagaattgggatccattttatactgagatt
ttgggaaggcccaccaccttagctgagacaatgggcaaagcagaaatgtggctcattaga
tcctactgggatttggagtttccccacccaacattaccaaatgttgactacattggagga
ctccaatgcaaacctgctaaacccttgcccaaggatatagaagactttgtccagagctct
ggagagcatggtgtggtggtgttttctctggggtcaatggtcagcagcatgacagaagaa
aaggccaacgcagttgcatgggcccttgcccagattccacaaaaggttctttggaaattt
gatggcaaaaccccagcaaccttaggacccaataccagagtctacaagtggcttccccag
aatgacctccttggtcatccaaaaaccaaagcctttgtaactcatggtggagccaatggt
gtctatgaggccatctatcatggaatccctatgattggcattcctatgtttggagaacaa
catgataacattgcccacatggtggccaaaggagcagctgttacactgaatatcaggaca
atgtcaaagtcagatttgttcaatgcacttaaggaagtaataaacaatcctttctataaa
aaaaatgctatgtggctgtcaaccattcaccatgaccaacctatgaaacccctggacaag
gctatcttctggattgagtatgtcatgcgccacaaaagagccaagcacctgagaccactt
ggacataaccttccctggtaccagtaccactctctggatgtgattggattcctgctagcc
tgtttggcagtcattgcagcccttgctgtaaaatgcttcttgttcatttaccgattcttt
gcaaagaagcaaaagaaaatgaagaatgagtag

KEGG   Rattus norvegicus (rat): 301595
Entry
301595            CDS       T01003                                 

Gene name
Ugt1a8
Definition
(RefSeq) UDP-glucuronosyltransferase 1A8 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    301595 (Ugt1a8)
   00053 Ascorbate and aldarate metabolism
    301595 (Ugt1a8)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    301595 (Ugt1a8)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    301595 (Ugt1a8)
   00860 Porphyrin and chlorophyll metabolism
    301595 (Ugt1a8)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    301595 (Ugt1a8)
   00982 Drug metabolism - cytochrome P450
    301595 (Ugt1a8)
   00983 Drug metabolism - other enzymes
    301595 (Ugt1a8)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    301595 (Ugt1a8)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    301595 (Ugt1a8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    301595 (Ugt1a8)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     301595 (Ugt1a8)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   301595 (Ugt1a8)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C AMPK1_CBM IP_trans Pox_A14
Other DBs
NCBI-GeneID: 301595
NCBI-ProteinID: NP_787040
RGD: 708474
Ensembl: ENSRNOG00000018740
UniProt: Q6T5E7
Position
9
AA seq 530 aa
MAPSGCPPSLPLCVCLFLASGFAQAGRLLVVPMDGSHWFTMQMIVEKLSHRGHEVVVVIP
EVSWHMGKSLNFTVKTYSVSYTLEDLNYHFKFFAHNQWKTQEVGMFSLLKHSGKGFFELL
FSHCRSLFKDKKLVEYLKQSSFDAVFLDPFDVCGLILAKYFSLPSVVFSGGIFCHYLDEG
AQCPSPPSYVPRILSKFTDTMTFKERVWNHLSYMKERAFCPYFFKTAVEIASEVLQTPVT
MRDLFSPVSIWMFRTDFVLEFPRPVMPNMVYIGGINCHQGKPLSKEFEAYVNASGEHGIV
VFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGH
PKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDL
ENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggctccttcaggctgtccaccctcccttcctctgtgtgtttgtctgttcctggcctct
ggctttgcccaggcaggcaggctgctggtagtgcccatggacgggagccactggttcacc
atgcagatgattgtggagaaactgagtcacagagggcatgaggtggtggtagtcatccca
gaggtgagttggcacatgggaaagtcgctgaattttaccgtgaaaacttactcagtttct
tacactctggaagatttaaactaccacttcaagttttttgctcacaaccaatggaaaact
caagaagtagggatgttttctctactgaagcattcaggcaaaggtttcttcgaattactg
ttttcacactgtaggagtttgtttaaggacaagaagttagtggagtacttgaagcagagt
tcgtttgatgctgtgtttctggatccttttgatgtgtgtggcttaattcttgccaagtac
ttttctctcccgtccgtggtcttcagcgggggaatattttgccactaccttgatgagggt
gcccagtgccccagtcctccttcttatgttcccagaattctctcaaaattcacagacacc
atgactttcaaggagagagtgtggaaccatctctcctacatgaaggagcgtgcattttgc
ccctactttttcaaaactgccgtagaaattgcctctgaagttctccagaccccggtgact
atgagagacctcttcagcccagtgtccatttggatgtttcgaactgactttgtgctggag
ttccccagacctgtgatgcccaacatggtctacattggtgggatcaactgccaccagggg
aagccactttccaaggaatttgaagcctatgtcaacgcctccggagaacatggcatcgtg
gttttctctttgggatccatggtctcagagattccagagaagaaagcgatggaaattgct
gaggctttgggcagaattcctcagacggtcctgtggcgctacaccggaactagaccatcg
aaccttgcaaagaacactattcttgtcaaatggctaccccaaaacgatctgcttggtcat
ccaaaggctcgggcgttcatcacacactccggttcccatggtatttatgaaggaatatgc
aatggggttccaatggtgatgatgcccttgtttggtgatcagatggacaacgccaagcgc
atggaaactcggggagctggggtgaccctgaatgtcctggaaatgactgccgatgatttg
gaaaacgcccttaaaactgtcatcaataacaagagttacaaggagaacatcatgcgcctc
tccagccttcacaaggaccgtcctatcgagcctctggacctggctgtgttctgggtggag
tacgtgatgaggcacaagggggcgccacacctgcgccccgccgcccacgacctcacctgg
taccagtaccactccttggacgtgattggctttctcctggccatcgtgttgacggtggtc
ttcattgtctataaaagttgtgcctatggctgccggaaatgctttgggggaaagggtcga
gtgaagaaatcacacaaatccaagacccactga

KEGG   Rattus norvegicus (rat): 305264
Entry
305264            CDS       T01003                                 

Gene name
Ugt2b10
Definition
(RefSeq) UDP-glucuronosyltransferase 2B10 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    305264 (Ugt2b10)
   00053 Ascorbate and aldarate metabolism
    305264 (Ugt2b10)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    305264 (Ugt2b10)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    305264 (Ugt2b10)
   00860 Porphyrin and chlorophyll metabolism
    305264 (Ugt2b10)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    305264 (Ugt2b10)
   00982 Drug metabolism - cytochrome P450
    305264 (Ugt2b10)
   00983 Drug metabolism - other enzymes
    305264 (Ugt2b10)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    305264 (Ugt2b10)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    305264 (Ugt2b10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    305264 (Ugt2b10)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     305264 (Ugt2b10)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   305264 (Ugt2b10)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C DUF577
Other DBs
NCBI-GeneID: 305264
NCBI-ProteinID: NP_001178605
RGD: 1309989
Ensembl: ENSRNOG00000001990
UniProt: D4A132
Position
14
AA seq 532 aa
MSVKRTASLLLLLLQLSDFFGSGTGGKVLVWPMEFSHWLNLRVILDELLKKGHEVTVLRP
SASLSYEVDNTSAIEFETYPTSYSLTEVDEFFWESLRKYIYELPKQSFWGYFLMFQELVW
VDSDYFESLCKDVVFNKELMTKLQNSGFDVILADPFIPCGDLLAEILKIPLVYSLRFFPG
STYEKYSGGLPMPPSYVPIAMSELSDRMTFVERMKHMIYVLCFDFWFQAFNEKKWNELYT
EVLGRPTTLSETMAKADIWLIRTYWDLEFPHPVLPNFDFVGGLHCRPAKPLPKEIEDFVQ
SSGEHGVVVFSLGSMVGNLTEERANVIAAGLAQIPQKVLWRFEGKKPETLGSNTRLYKWI
PQNDLLGHPKTRAFITHGGTNGIYEAIYHGIPVVGIPLFGDQYDNIVHLKTKGAAVRLDF
LTMSSTDLFTALKTITNDPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLR
VAAHDLSWVQYHSLDVIGFLLACVVTVMFILKKCCLFCCQKFTKAGRKKKRE
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgtctgtgaaaaggacagcatccctgctcctgctcctgctccagctgagtgacttcttt
ggatctggaactggtgggaaggtgctagtgtggccaatggagttcagccattggctcaac
ttaagggtgatcctagatgaacttctgaagaagggtcatgaagtgacggttctgagacct
tcggcgtccttatcttatgaggttgacaacacatctgctattgaattcgagacttatcct
acatcatactcattaactgaggtagacgaatttttctgggaatcactcagaaaatatatt
tatgagctgccaaagcagtcattttggggatactttttaatgtttcaagaattggtttgg
gtagattcagattattttgagagtctctgtaaagatgtagtctttaacaaagaactcatg
acgaagctacaaaactctggctttgatgtcatcctggcagatcccttcataccctgtggt
gacctgctggccgagattctcaagatacccttagtgtacagtctccgcttctttcctggc
tccacttatgaaaagtacagtggaggactcccaatgcctccttcctatgtgcccattgct
atgtcagaattaagcgacagaatgacattcgtggagaggatgaaacacatgatctatgta
ctttgttttgacttttggttccaagcatttaatgagaagaagtggaacgagctttacact
gaagtattaggaagacccactacactctcagagactatggcaaaggcagacatatggctc
attaggacctactgggatttggaattccctcaccctgtcttaccaaattttgattttgtt
ggtggactccactgcagacctgccaaacccctgcctaaggaaatagaagacttcgtccag
tcatctggagaacatggtgttgtggtgttttccctggggtcgatggtgggaaacctaaca
gaagaaagggccaatgtgattgcagcaggccttgcccagattccacagaaggttctttgg
agatttgaaggcaagaagccagaaaccttgggctccaacactcgtctgtacaaatggatc
ccccagaatgaccttctaggtcatcccaaaaccagagcttttataactcatggtggcacc
aatggcatctatgaggcaatctaccacgggattcctgtggttggcattcctttgtttgga
gatcaatatgacaatattgttcacttgaagacaaaaggagcagcagttagactggacttt
ctcaccatgtccagtacagacttgttcactgcactgaagacaatcactaatgacccttcc
tataaggagaatgccatgagattatcaagaatccaccacgatcagccagtgaaacctctg
gatagagccgtcttctggattgagtttgtcatgcgtcacaaaggagccaagcaccttcgt
gtggcagcgcatgacctcagctgggtccaataccactctctggatgtcattgggttcctg
ctggcctgtgtggtgactgtgatgttcatcctcaaaaagtgttgcctcttttgttgtcag
aagtttacaaaagctggaagaaagaagaaaagggaatag

KEGG   Rattus norvegicus (rat): 396527
Entry
396527            CDS       T01003                                 

Gene name
Ugt1a2
Definition
(RefSeq) UDP-glucuronosyltransferase 1-2 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    396527 (Ugt1a2)
   00053 Ascorbate and aldarate metabolism
    396527 (Ugt1a2)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    396527 (Ugt1a2)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    396527 (Ugt1a2)
   00860 Porphyrin and chlorophyll metabolism
    396527 (Ugt1a2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    396527 (Ugt1a2)
   00982 Drug metabolism - cytochrome P450
    396527 (Ugt1a2)
   00983 Drug metabolism - other enzymes
    396527 (Ugt1a2)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    396527 (Ugt1a2)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    396527 (Ugt1a2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    396527 (Ugt1a2)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     396527 (Ugt1a2)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   396527 (Ugt1a2)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Pox_A14
Other DBs
NCBI-GeneID: 396527
NCBI-ProteinID: NP_958826
RGD: 1549741
Ensembl: ENSRNOG00000018740
UniProt: Q6T5F2
Position
9
AA seq 533 aa
MDTGLCAPLRGLSGLLLLLCALPWAEGGKVLVFPMEGSHWLSMRDVVRELHARGHQAVVL
APEVTVHMKGEDFFTLQTYAFPYTKEEYQREILGNAKKGFEPQHFVKTFFETMASIKKFF
DLYANSCAALLHNKTLIQQLNSSSFDVVLTDPVFPCGALLAKYLQIPAVFFLRSVPCGID
YEATQCPKPSSYIPNLLTMLSDHMTFLQRVKNMLYPLTLKYICHLSITPYESLASELLQR
EMSLVEVLSHASVWLFRGDFVFDYPRPIMPNMVFIGGINCVIKKPLSQEFEAYVNASGEH
GIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDL
LGHPKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTA
DDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHD
LTWYQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggacacaggattgtgtgcaccccttcgaggactctcaggactgctgctcctgctgtgt
gccctgccctgggctgaaggtggaaaggtgctggtgtttcccatggagggcagccactgg
ctgagcatgagggatgtcgtgagggagctccacgcccgaggtcaccaggctgtggtcctg
gctccagaggtgactgtgcacatgaaaggagaggacttcttcaccctccaaacctatgcc
tttccatataccaaggaagaatatcagcgggaaatactgggcaacgctaagaagggcttc
gaaccacaacattttgtgaagactttctttgaaactatggcatctataaaaaagtttttc
gatctctacgcaaattcttgtgcagctctattgcacaataagaccctgatccagcaactg
aattccagttccttcgatgtggtcttaacagaccctgttttcccctgtggagcattactg
gccaagtatctacagattcctgctgtgttttttctgcgctctgttccctgtggcatagac
tatgaggctacacaatgtccgaaaccttcctcttatattccgaacctactcacaatgctt
tctgaccacatgaccttcctgcaaagggtcaagaacatgctgtaccctctgaccttgaag
tacatttgccatttatcaatcactccctatgaaagcctggcctctgagcttttgcagaga
gaaatgtctttagtggaggttctcagtcatgcatctgtgtggctgttccgaggggacttt
gtgtttgactacccgaggcccatcatgcctaatatggtcttcattggaggcataaactgt
gtcatcaagaagcccctctctcaggaatttgaagcctatgtcaacgcctccggagaacat
ggcatcgtggttttctctttgggatccatggtctcagagattccagagaagaaagcgatg
gaaattgctgaggctttgggcagaattcctcagacggtcctgtggcgctacaccggaact
agaccatcgaaccttgcaaagaacactattcttgtcaaatggctaccccaaaacgatctg
cttggtcatccaaaggctcgggcgttcatcacacactccggttcccatggtatttatgaa
ggaatatgcaatggggttccaatggtgatgatgcccttgtttggtgatcagatggacaac
gccaagcgcatggaaactcggggagctggggtgaccctgaatgtcctggaaatgactgcc
gatgatttggaaaacgcccttaaaactgtcatcaataacaagagttacaaggagaacatc
atgcgcctctccagccttcacaaggaccgtcctatcgagcctctggacctggctgtgttc
tgggtggagtacgtgatgaggcacaagggggcgccacacctgcgccccgccgcccacgac
ctcacctggtaccagtaccactccttggacgtgattggctttctcctggccatcgtgttg
acggtggtcttcattgtctataaaagttgtgcctatggctgccggaaatgctttggggga
aagggtcgagtgaagaaatcacacaaatccaagacccactga

KEGG   Rattus norvegicus (rat): 396551
Entry
396551            CDS       T01003                                 

Gene name
Ugt1a3
Definition
(RefSeq) UDP-glucuronosyltransferase 1A3 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    396551 (Ugt1a3)
   00053 Ascorbate and aldarate metabolism
    396551 (Ugt1a3)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    396551 (Ugt1a3)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    396551 (Ugt1a3)
   00860 Porphyrin and chlorophyll metabolism
    396551 (Ugt1a3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    396551 (Ugt1a3)
   00982 Drug metabolism - cytochrome P450
    396551 (Ugt1a3)
   00983 Drug metabolism - other enzymes
    396551 (Ugt1a3)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    396551 (Ugt1a3)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    396551 (Ugt1a3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    396551 (Ugt1a3)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     396551 (Ugt1a3)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   396551 (Ugt1a3)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Pox_A14
Other DBs
NCBI-GeneID: 396551
NCBI-ProteinID: NP_958827
RGD: 1549728
Ensembl: ENSRNOG00000018740
UniProt: Q6T5F1
Position
9
AA seq 531 aa
MGIQGFLQKLSGLLLLLCALPWAEGGKVLVFPMEGSHWLSMRDVVRELHARGHQAVVLAP
EVTVHIKEEDFFTLQTYPVPYTKEEYRHHLLGHLQNFFETEFSLKLVLQRMAAVNNVSTF
YVRSCRGLLHNTALIQSLNSSSFDVVLTDPFFPCGAVLAMYLRVPAVFFLQSMLCELEFE
ATNSPNPSSYIPRLLTLNSDHMSFLDRVKNMLYPVPWMYLCHVNYGSLARLASDLLQREV
SVVEILRHASVWLLRKDFVFYYPRPFMPNMVFIGGINCANRKPLSQEFEAYVNASGEHGI
VVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLG
HPKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADD
LENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLT
WYQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgggaatccaagggttcctgcagaaactctcaggactgctgctcctgctgtgtgccctg
ccctgggctgaaggtggaaaggtgctggtgtttcccatggagggcagccactggctgagc
atgagggatgtcgtgagggagctccacgcccgaggtcaccaggctgtggtcctggctcca
gaggtgactgtgcacatcaaagaagaggacttcttcaccctccaaacctaccctgttcca
tacaccaaggaagagtacaggcaccacttgctgggccaccttcaaaattttttcgaaact
gaattttctctgaagttagttctacagagaatggcagctgtaaataacgtatcaacattc
tatgtgagatcttgcaggggtctgctgcataacacagctctgatccagagcctgaactcc
agctccttcgatgtggttttaacagatccctttttcccctgtggggcagtgctggccatg
tacctgcgtgttcctgctgtgttttttctgcaatccatgctctgtgaactggaatttgaa
gcaacaaacagtccaaacccttcttcttatattcccaggttactaacattgaattctgac
cacatgagcttcctagacagagtgaagaatatgctttatcctgtgccatggatgtattta
tgccatgttaattatggctctctggcgagacttgcgtcagaccttttgcagagggaggta
tccgtggtagagatcctcagacatgcctctgtatggctgttgagaaaggactttgtgttc
tactaccccaggcccttcatgcccaacatggtcttcattgggggcataaactgtgccaac
aggaagccactgtctcaggaatttgaagcctatgtcaacgcctccggagaacatggcatc
gtggttttctctttgggatccatggtctcagagattccagagaagaaagcgatggaaatt
gctgaggctttgggcagaattcctcagacggtcctgtggcgctacaccggaactagacca
tcgaaccttgcaaagaacactattcttgtcaaatggctaccccaaaacgatctgcttggt
catccaaaggctcgggcgttcatcacacactccggttcccatggtatttatgaaggaata
tgcaatggggttccaatggtgatgatgcccttgtttggtgatcagatggacaacgccaag
cgcatggaaactcggggagctggggtgaccctgaatgtcctggaaatgactgccgatgat
ttggaaaacgcccttaaaactgtcatcaataacaagagttacaaggagaacatcatgcgc
ctctccagccttcacaaggaccgtcctatcgagcctctggacctggctgtgttctgggtg
gagtacgtgatgaggcacaagggggcgccacacctgcgccccgccgcccacgacctcacc
tggtaccagtaccactccttggacgtgattggctttctcctggccatcgtgttgacggtg
gtcttcattgtctataaaagttgtgcctatggctgccggaaatgctttgggggaaagggt
cgagtgaagaaatcacacaaatccaagacccactga

KEGG   Rattus norvegicus (rat): 396552
Entry
396552            CDS       T01003                                 

Gene name
Ugt1a9
Definition
(RefSeq) UDP glycosyltransferase 1 family, polypeptide A10 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    396552 (Ugt1a9)
   00053 Ascorbate and aldarate metabolism
    396552 (Ugt1a9)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    396552 (Ugt1a9)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    396552 (Ugt1a9)
   00860 Porphyrin and chlorophyll metabolism
    396552 (Ugt1a9)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    396552 (Ugt1a9)
   00982 Drug metabolism - cytochrome P450
    396552 (Ugt1a9)
   00983 Drug metabolism - other enzymes
    396552 (Ugt1a9)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    396552 (Ugt1a9)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    396552 (Ugt1a9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    396552 (Ugt1a9)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     396552 (Ugt1a9)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   396552 (Ugt1a9)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Pox_A14
Other DBs
NCBI-GeneID: 396552
NCBI-ProteinID: NP_958828
RGD: 1549771
Ensembl: ENSRNOG00000018740
UniProt: Q6T5F3
Position
9
AA seq 530 aa
MAPSGCPSSLPLCVCLFLASGFAQAGRLLVVPMDGSHWFTRQMTVEKLLQRGHEVGVVIP
EESWQLGKLVNCTVKTYSIPYTVEDMDREFKHFSYTQWKTPEQSMYSLITGSVKDFLEIT
FSHCRSLFKDKKLVEYLKQSSFDAVFLDPFHVCGLTVAKYLSLPSIIFAKDIFCDNLKEG
AQCPSLPSYVPRLFSKSADTMSFKERLWNHLIYFEERAFCSYYLKTAIEIASEVLQTPVT
LTDLYSPVSIWLLRTDFVFNFPRPVMPNMVFVGGINCFQRKPLSKEFEAYVNASGEHGIV
VFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGH
PKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDL
ENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggctccttcaggctgtccatcctcccttcctctgtgtgtgtgtctgttcctggcctct
ggatttgcccaggcaggcaggctgctggtggtgcccatggatgggagccactggttcacc
aggcagatgactgtggagaaactcctccagagagggcatgaggtaggggtagtcatccca
gaggagagttggcagctgggaaaattggtgaattgtacagtgaagacatactcaattcct
tacactgtggaggatatggaccgtgaattcaagcatttttcgtacactcaatggaaaact
ccagaacaaagtatgtattctttaataacaggctcagtcaaagatttcttagaaataaca
ttttcacactgtaggagtttgtttaaggacaagaagttagtggagtacttgaagcagtct
tcttttgatgctgtgtttctggatccttttcacgtgtgtggcttaactgttgccaaatat
ttgtcactgccatcaataatttttgccaaagacatattttgcgacaatcttaaagagggt
gcccagtgcccaagtcttccttcttatgttcctagacttttctcaaaatccgcagacacc
atgagtttcaaggagcgattgtggaaccatcttatctactttgaagaacgtgcattttgc
tcctattatttgaaaactgctatagaaattgcctctgaggttctgcagaccccagtgact
ctgacagacctctacagcccagtgtccatttggttgttacgcactgactttgtgttcaac
ttccccagacctgtgatgcccaacatggtctttgttggtggcatcaactgcttccagagg
aagccactttccaaggaatttgaagcctatgtcaacgcctccggagaacatggcatcgtg
gttttctctttgggatccatggtctcagagattccagagaagaaagcgatggaaattgct
gaggctttgggcagaattcctcagacggtcctgtggcgctacaccggaactagaccatcg
aaccttgcaaagaacactattcttgtcaaatggctaccccaaaacgatctgcttggtcat
ccaaaggctcgggcgttcatcacacactccggttcccatggtatttatgaaggaatatgc
aatggggttccaatggtgatgatgcccttgtttggtgatcagatggacaacgccaagcgc
atggaaactcggggagctggggtgaccctgaatgtcctggaaatgactgccgatgatttg
gaaaacgcccttaaaactgtcatcaataacaagagttacaaggagaacatcatgcgcctc
tccagccttcacaaggaccgtcctatcgagcctctggacctggctgtgttctgggtggag
tacgtgatgaggcacaagggggcgccacacctgcgccccgccgcccacgacctcacctgg
taccagtaccactccttggacgtgattggctttctcctggccatcgtgttgacggtggtc
ttcattgtctataaaagttgtgcctatggctgccggaaatgctttgggggaaagggtcga
gtgaagaaatcacacaaatccaagacccactga

KEGG   Rattus norvegicus (rat): 501907
Entry
501907            CDS       T01003                                 

Gene name
RGD1559459
Definition
(RefSeq) UDP-glucuronosyltransferase 2B31-like isoform X1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    501907 (RGD1559459)
   00053 Ascorbate and aldarate metabolism
    501907 (RGD1559459)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    501907 (RGD1559459)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    501907 (RGD1559459)
   00860 Porphyrin and chlorophyll metabolism
    501907 (RGD1559459)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    501907 (RGD1559459)
   00982 Drug metabolism - cytochrome P450
    501907 (RGD1559459)
   00983 Drug metabolism - other enzymes
    501907 (RGD1559459)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    501907 (RGD1559459)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    501907 (RGD1559459)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    501907 (RGD1559459)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     501907 (RGD1559459)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   501907 (RGD1559459)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-GeneID: 501907
NCBI-ProteinID: XP_003751392
RGD: 1559459
Ensembl: ENSRNOG00000042714
UniProt: F1LTB8
Position
14
AA seq 530 aa
MSVKMTAALLLLHLTIFFGSGSGGKVLVWPVEFSHWLNLKIILSELVKKGHEVVVLKPSV
SFSYEVDKTSAIEFESFPSSYSIADVEVIFMDCVNESIYELPKQSFWGYFLMLQKLFERT
SDYSERLCRDAAFNKELMTKLQNSGFDVILADPFTPCGDLLAEILKIPLVYSLRFFPGST
YEKYSGGLPMPPSYVPIAMSELSDRMTFVERVKHMIYVLCFDFWFQVFDEKKWNELYTEV
LGRPTTLSETMAKADIWLIRTYWDLEFPHPVLPNFDFVGGLHCRPAKPLPKEIEDFVQSS
GEHGVVVFSLGSMVGSLTEERANVIAAGLAQIPQKVLWRFEGKKPETLGSNTRLYKWIPQ
NDLLGHPKTRAFITHGGTNGIYEAIYHGIPVVGIPLFGDQKDNIVHLKTKGAAVRLDFLT
MSSTDLLTALRTVTNDPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVA
GHDLSWVQYHSLDVIGFLLACVVTVMFILKKCCLFCCQKFTKAGRKKKKE
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgtctgtgaaaatgacagcggccctgctcctgctccacctgaccatcttctttggctct
gggagtggtgggaaagtgctggtgtggcctgtggaattcagccattggctcaacttgaag
ataatcctaagtgagctggtgaagaagggtcatgaagtagttgtgctgaaaccttcagtt
tccttttcttacgaggtcgacaaaacatctgctattgagtttgagtcgttcccttcatcg
tattccatagctgatgtggaggtgatttttatggactgcgtcaatgagagcatttacgag
ctaccgaagcagtcattttggggatactttttaatgttgcaaaaactttttgaaaggact
tcagattattctgagcgtctctgtagagatgcagcttttaataaagaactcatgacgaag
ctacaaaactctggctttgatgtcatcctggcagatcccttcacaccctgtggtgacctg
ctggccgagattctcaagatacccttagtgtacagtctccgcttctttcctggctccact
tatgaaaagtacagtggaggactcccaatgcctccttcctatgtgcccattgctatgtca
gaattaagcgacagaatgacattcgtggagagggtgaaacatatgatctatgtactttgt
tttgacttttggttccaagtgtttgatgagaagaagtggaacgagctttacactgaagta
ttaggaagacccactacactctcagagactatggcaaaggcagacatatggctcattagg
acctactgggatttggaattccctcaccccgtcttaccaaattttgattttgttggtgga
ctccactgcagacctgccaaacccctgcctaaggaaatagaagacttcgtccagtcatct
ggagaacatggtgttgtggtgttttccctcgggtcgatggtgggaagcctaacagaagaa
agggccaatgtgattgcagcaggccttgcccagattccacagaaggttctttggagattt
gaaggcaagaagccagaaaccttgggctccaacactcgtctgtacaaatggatcccccag
aatgaccttctaggtcatcccaaaaccagagcttttataactcatggtggcaccaatggc
atctatgaggcaatctaccacgggattcctgtggttggcattcctttgtttggagaccaa
aaggacaatattgttcacttgaagaccaaaggagcagcagttagactggactttctcacg
atgtccagtacagacttgctcactgcactgaggacagtcactaatgacccttcctataag
gagaatgccatgagattatcaagaatccaccacgaccagccagtgaaacctctggataga
gccgtcttctggattgagtttgtcatgcgccacaaaggagccaagcaccttcgtgtggca
gggcatgacctcagctgggtccaataccactctctggatgtcattgggttcctgctggcc
tgtgtggtgactgtgatgttcatcctcaaaaagtgttgcctcttttgttgtcagaagttt
acaaaagctggaagaaagaagaaaaaggagtag

KEGG   Rattus norvegicus (rat): 574523
Entry
574523            CDS       T01003                                 

Gene name
Ugt1a5
Definition
(RefSeq) UDP-glucuronosyltransferase 1A5 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    574523 (Ugt1a5)
   00053 Ascorbate and aldarate metabolism
    574523 (Ugt1a5)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    574523 (Ugt1a5)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    574523 (Ugt1a5)
   00860 Porphyrin and chlorophyll metabolism
    574523 (Ugt1a5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    574523 (Ugt1a5)
   00982 Drug metabolism - cytochrome P450
    574523 (Ugt1a5)
   00983 Drug metabolism - other enzymes
    574523 (Ugt1a5)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    574523 (Ugt1a5)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    574523 (Ugt1a5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    574523 (Ugt1a5)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     574523 (Ugt1a5)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   574523 (Ugt1a5)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Pox_A14
Other DBs
NCBI-GeneID: 574523
NCBI-ProteinID: NP_001034638
RGD: 1583689
Ensembl: ENSRNOG00000018740
UniProt: Q6T5F0
Position
9
AA seq 531 aa
MGLHVTLQGLAGLLLLLYALPWAEGGKVLVFPMEGSHWLSMRDVVRELHARGHQAVVLAP
EVTVHIKEEDFFTLQTYPVPYTRQGFRQQMMRNIKVVFETGNYVKTFLETSEILKNISTV
LLRSCMNLLHNGSLLQHLNSSSFDMVLTDPVIPCGAVLAKYLGIPTVFFLRYIPCGIDSE
ATQCPKPSSYIPNLLTMLSDHMTFLQRVKNMLYPLALKYICHFSFTRYESLASELLQREV
SLVEVLSHASVWLFRGDFVFDYPRPVMPNMVFIGGINCVIKKPLSQEFEAYVNASGEHGI
VVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLG
HPKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADD
LENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLT
WYQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgggactccatgtgaccctgcaaggattagctgggctgctgctgctgctgtatgccctg
ccctgggctgaaggtggaaaggtgctggtgtttcccatggagggcagccactggctgagc
atgagggatgtcgtgagggagctccacgcccgaggtcaccaggctgtggtcctggctcca
gaggtgactgtgcacatcaaagaagaggacttcttcaccctccaaacctaccctgttcca
tacacaagacaaggatttagacaacaaatgatgcgaaacattaaagtggtctttgaaaca
ggcaactatgtgaagacattccttgaaacatccgagattttgaaaaacatatcgacagtt
ctcttaaggtcttgtatgaatctattgcacaatgggtccctgctccagcatctgaattcc
agctcctttgacatggtcttaacagatcctgtgattccgtgtggggcagtgctggccaag
tacttgggtatccccactgtgttctttctacgatacattccctgtggcatagactctgag
gccacacaatgtccgaaaccttcctcttatattccgaacctactcacaatgctttctgac
cacatgactttcctgcaaagggtcaagaacatgctgtaccctctggccttgaagtacatt
tgccatttctcattcactcgctatgaaagcctggcctctgagcttttgcagagagaagtg
tctttagtggaggttctcagccatgcatctgtgtggctgttccgaggggactttgtgttc
gactacccgaggcctgtcatgcctaacatggtcttcattggaggcataaactgtgtcatc
aagaagcctctttctcaggaatttgaagcctatgtcaacgcctccggagaacatggcatc
gtggttttctctttgggatccatggtctcagagattccagagaagaaagcgatggaaatt
gctgaggctttgggcagaattcctcagacggtcctgtggcgctacaccggaactagacca
tcgaaccttgcaaagaacactattcttgtcaaatggctaccccaaaacgatctgcttggt
catccaaaggctcgggcgttcatcacacactccggttcccatggtatttatgaaggaata
tgcaatggggttccaatggtgatgatgcccttgtttggtgatcagatggacaacgccaag
cgcatggaaactcggggagctggggtgaccctgaatgtcctggaaatgactgccgatgat
ttggaaaacgcccttaaaactgtcatcaataacaagagttacaaggagaacatcatgcgc
ctctccagccttcacaaggaccgtcctatcgagcctctggacctggctgtgttctgggtg
gagtacgtgatgaggcacaagggggcgccacacctgcgccccgccgcccacgacctcacc
tggtaccagtaccactccttggacgtgattggctttctcctggccatcgtgttgacggtg
gtcttcattgtctataaaagttgtgcctatggctgccggaaatgctttgggggaaagggt
cgagtgaagaaatcacacaaatccaagacccactga

KEGG   Rattus norvegicus (rat): 63867
Entry
63867             CDS       T01003                                 

Gene name
Ugt2a1
Definition
(RefSeq) UDP-glucuronosyltransferase 2A1 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    63867 (Ugt2a1)
   00053 Ascorbate and aldarate metabolism
    63867 (Ugt2a1)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    63867 (Ugt2a1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    63867 (Ugt2a1)
   00860 Porphyrin and chlorophyll metabolism
    63867 (Ugt2a1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    63867 (Ugt2a1)
   00982 Drug metabolism - cytochrome P450
    63867 (Ugt2a1)
   00983 Drug metabolism - other enzymes
    63867 (Ugt2a1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    63867 (Ugt2a1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    63867 (Ugt2a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    63867 (Ugt2a1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     63867 (Ugt2a1)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   63867 (Ugt2a1)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C
Other DBs
NCBI-GeneID: 63867
NCBI-ProteinID: NP_071564
RGD: 69432
UniProt: P36510
Position
14
AA seq 527 aa
MLKNILLWSLQLSLLGMSLGGNVLIWPMEGSHWLNVKIIIDELLRKEHNVTVLVASGALF
ITPSVSPSLTFEIYPVPFGKEKIESVIKDFVLTWLENRPSPSTIWTFYKEMAKVIEEFHL
VSRGICDGVLKNEKLMTKLQRGKFEVLLSDPVFPCGDIVALKLGIPFIYSLRFSPASTVE
KHCGKVPFPPSYVPAILSELTDQMSFADRVRNFISYRMQDYMFETLWKQWDSYYSKALGR
PTTLCETMGKAEIWLMRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFVQTSGEH
GVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYKGKIPATLGSNTRLFDWIPQNDL
LGHPKTRAFITHGGTNGIYEAIYHGIPMVGVPMFADQPDNIAHMKAKGAAVEVNMNTMTS
ADLLSAVRAVINEPFYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHD
LSWFQYHSLDVIGFLLACMASAILLVIKCCLFVFQKIGKTXKKNKRD
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgttgaagaacattctactgtggtctcttcagctaagtctcctaggaatgagtcttggc
gggaatgttctcatctggccaatggaaggcagtcactggctaaatgttaagatcataata
gacgaactcctaaggaaagagcataacgtgactgtccttgttgcatccggggcccttttc
atcacaccgtcggtcagcccatctctgacattcgaaatatatccagtgcccttcggcaag
gaaaaaatcgaaagcgtgatcaaggactttgttttgacgtggctggaaaacaggccgtct
ccttcaactatctggactttctataaggaaatggccaaagtcatcgaggagttccacttg
gtgtccagagggatctgtgatggcgttcttaagaatgaaaagctgatgaccaagctgcag
agaggaaagtttgaagtactgttgtcagacccagtatttccgtgtggcgatatcgtagct
ttaaaactggggattccatttatctattccttgcggttttctcctgcctccacagtggaa
aagcactgtggaaaagtcccgtttcctccttcctatgttcctgcaatcttgtcagaactc
acagaccagatgtccttcgctgaccgagtaaggaactttatctcctaccgaatgcaggac
tacatgtttgaaactctttggaagcaatgggattcctattacagtaaagccttaggaaga
cccaccacactgtgcgagactatggggaaagctgagatttggctaatgcgaacatattgg
gattttgaatttcctcgtccatatttgcctaattttgagtttgtgggaggactgcactgc
aaacctgccaagcctttgcctaaggaaatggaagagtttgtccagacctcaggggaacat
ggtgttgtggtgttttctttggggtcaatggtcaaaaacctgacagaagaaaaggccaat
ctcattgcctcagcccttgcccagattcctcagaaggttttgtggcgatacaaaggaaag
ataccagccacattaggatccaatacgagattgtttgactggattcctcagaatgatctt
cttggacatcccaaaaccagagcttttatcacccatggtggaacaaatggaatctatgag
gccatttaccacgggatcccgatggtgggagttcccatgttcgctgatcagcctgacaac
atagctcacatgaaggctaaaggagcagctgtggaggtgaacatgaacacgatgacgagt
gcagatctgctcagtgctgtgagagcagtcatcaatgagccattttataaagagaatgcc
atgagactatcaagaattcaccacgatcagccagtgaagcccctggacagagccgtcttc
tggattgagtttgtcatgcgtcacaaaggagccaagcaccttcgtgtggcagcgcatgac
ctcagctggtttcagtaccactctctagatgtgattgggttcctgctggcttgtatggca
tctgccatattattggttataaaatgttgtttatttgtatttcaaaaaattggtaagaca
ngaaagaagaataaaagggactag

KEGG   Rattus norvegicus (rat): 83808
Entry
83808             CDS       T01003                                 

Gene name
Ugt2b35
Definition
(RefSeq) UDP-glucuronosyltransferase 2B15 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    83808 (Ugt2b35)
   00053 Ascorbate and aldarate metabolism
    83808 (Ugt2b35)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    83808 (Ugt2b35)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    83808 (Ugt2b35)
   00860 Porphyrin and chlorophyll metabolism
    83808 (Ugt2b35)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    83808 (Ugt2b35)
   00982 Drug metabolism - cytochrome P450
    83808 (Ugt2b35)
   00983 Drug metabolism - other enzymes
    83808 (Ugt2b35)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    83808 (Ugt2b35)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    83808 (Ugt2b35)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    83808 (Ugt2b35)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     83808 (Ugt2b35)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   83808 (Ugt2b35)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-GeneID: 83808
NCBI-ProteinID: NP_001004271
RGD: 620895
Ensembl: ENSRNOG00000001980
Vega: OTTRNOG00000000150
UniProt: Q68G19
Position
14
AA seq 530 aa
MPGKWISALLLLQISFCFKSGNCGKVLVWPMEYSHWMNIKIILEELVQKGHEVTVLRPSA
SVFLDPKETSDLKFVTFPTSFSSHDLENFFTRFVNVWTYELPRDTCLSYFLYLQDTIDEY
SDYCLTVCKEAVSNKQFMTKLQESKFDVVFSDAIGPCGELIAELLQIPFLYSLRFSPGYT
IEKYIGGVLFPPSYVPMIFSGLAGQMTFIERVHNMICMLYFDFWFQTFREKKWDPFYSKT
LGRPTTLAEIMGKAEMWLIRSYWDLEFPHPISPNVDYIGGLHCKPAKPLPKDIEDFVQSS
GEHGVVVFSLGSMVRNMTEEKANIIAWALAQIPQKVLWRFDGKKPPTLGPNTRLYKWLPQ
NDLLGHPKTKAFVTHGGANGIYEAIHHGIPMIGIPLFGEQHDNIAHMVAKGAAVEVNFRT
MSKSDMLNALEEVINNPFYKKNAMWLSTIHHDQPTKPLDRAVFWIEFVMRHKGAKHLRSL
GHNLPWYQYHSLDVIGFLLTCVAVTVVLALKCFLFVYRFFVKKEKKTKNE
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgcctgggaagtggatttctgctctgctcctgctgcaaataagtttctgctttaaatct
gggaactgcggaaaggtgttggtatggccgatggaatatagtcactggatgaatataaag
ataatactagaggaacttgtacagaagggccatgaagtcactgttctgagaccttcagct
tctgtctttcttgatcccaaggaaacttctgaccttaaatttgtaacttttcctacatct
ttcagtagtcatgacctggaaaatttttttacaaggtttgtgaatgtatggacttatgag
ttgccaagagacacatgtttgtcatattttctttatctacaagatacgattgatgaatat
tctgactactgtctgactgtttgtaaagaagcagtttcaaacaaacagttcatgacaaaa
ctacaggaatccaaatttgatgtcgttttctcagatgccattggtccctgtggagagctg
atagctgaactgctccagattccttttctgtacagtcttcgcttctctcctggctacaca
attgaaaagtacattggaggagttctattccctccctcttatgtacctatgattttttca
ggattagctggccaaatgacattcatagagagggtacacaatatgatatgtatgctttat
tttgacttttggttccaaacatttagagagaagaaatgggatccattttacagcaaaact
ttaggaaggcccaccacattagctgagataatgggcaaagcagaaatgtggctcattaga
tcctactgggatttggagtttccccacccaatatcgccaaatgttgactacattggagga
ctccactgcaaacctgctaaacccttgcccaaggatattgaagacttcgtccagagctct
ggagagcatggtgtggtggtgttttctctggggtcaatggtcaggaacatgacagaagaa
aaggccaacatcattgcatgggcccttgcccagattccacaaaaggttctttggagattt
gacggcaaaaaaccacccaccttaggacccaataccagactctacaagtggcttccccaa
aatgatcttcttggtcatccaaaaaccaaagcctttgtaacgcatggtggagccaatggc
atctatgaggcgatccatcatggaatccctatgattggcattcccctatttggagagcaa
catgataacattgcccacatggtggccaaaggagcagctgtggaagtaaatttcaggaca
atgtcaaagtcagatatgctcaatgcactggaggaagtcataaacaatcctttttataaa
aagaatgctatgtggttgtcaaccattcaccatgaccagcctacgaagccactggacaga
gctgtcttctggattgagtttgtcatgcgccacaaaggggccaagcacctgagatcactt
ggacataaccttccctggtaccagtaccactctctggatgtgattggattcctgctcacc
tgtgtggcagtcactgtagtccttgctctaaagtgctttttatttgtttatcgattcttt
gtaaagaaggaaaagaaaacaaagaatgagtag

DBGET integrated database retrieval system