KEGG   Rattus norvegicus (rat): 113995Help
Entry
113995            CDS       T01003                                 

Gene name
P2rx5, P2x5
Definition
(RefSeq) purinergic receptor P2X 5
  KO
K05219  P2X purinoceptor 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    113995 (P2rx5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113995 (P2rx5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    113995 (P2rx5)
Ion channels [BR:rno04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   113995 (P2rx5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P2X_receptor
Motif
Other DBs
NCBI-GeneID: 113995
NCBI-ProteinID: NP_542958
RGD: 620256
Ensembl: ENSRNOG00000019208
UniProt: P51578
Position
10q24
AA seq 455 aa AA seqDB search
MGQAAWKGFVLSLFDYKTAKFVVAKSKKVGLLYRVLQLIILLYLLIWVFLIKKSYQDIDT
SLQSAVVTKVKGVAYTNTTMLGERLWDVADFVIPSQGENVFFVVTNLIVTPNQRQGICAE
REGIPDGECSEDDDCHAGESVVAGHGLKTGRCLRVGNSTRGTCEIFAWCPVETKSMPTDP
LLKDAESFTISIKNFIRFPKFNFSKANVLETDNKHFLKTCHFSSTNLYCPIFRLGSIVRW
AGADFQDIALKGGVIGIYIEWDCDLDKAASKCNPHYYFNRLDNKHTHSISSGYNFRFARY
YRDPNGVEFRDLMKAYGIRFDVIVNGKAGKFSIIPTVINIGSGLALMGAGAFFCDLVLIY
LIRKSEFYRDKKFEKVRGQKEDANVEVEANEMEQERPEDEPLERVRQDEQSQELAQSGRK
QNSNCQVLLEPARFGLRENAIVNVKQSQILHPVKT
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggccaggcggcctggaaggggtttgtgctgtctctgttcgactataagactgcaaag
ttcgtggtcgccaagagcaagaaggtggggctgctctaccgggtgctgcagctcatcatc
ctgttgtacttgctcatatgggtgtttctgataaagaagagttatcaggacattgacact
tccctgcagagtgctgtggtcaccaaagtcaagggggtggcctatactaacaccacgatg
cttggggaacggctctgggatgtagcagactttgtcattccatctcagggggagaacgtt
ttcttcgtggtcaccaacctgatcgtgactcctaaccagcggcagggcatctgcgctgag
cgtgaaggcatccctgatggcgagtgttctgaggacgatgactgtcacgctggggagtct
gttgtagctgggcacggactgaaaactggccgctgtctccgggtggggaactctacccgg
ggaacctgtgagatctttgcttggtgcccagtggagacaaagtccatgccaacggatccc
cttctaaaggatgccgaaagcttcaccatttccataaagaacttcattcgcttccccaag
ttcaacttctccaaagccaatgtactagaaacagacaacaaacatttcctgaaaacctgt
cacttcagctccacaaatctctactgtcccatcttccgactggggtctattgtccgctgg
gcaggggcagacttccaggacatagccctgaagggtggtgtgataggaatctatattgaa
tgggactgtgaccttgataaagctgcctctaaatgcaacccacactactacttcaaccgc
ctggacaacaaacacacacactccatctcctctgggtacaacttcaggttcgccaggtat
taccgtgaccctaatggggtagagttccgtgacctgatgaaagcctacggcatccgcttt
gatgtgatagttaatggcaaggcaggaaaattcagcatcatccccacagtcatcaacatt
ggttctgggctggcgctcatgggtgctggggctttcttctgcgacctggtacttatctac
ctcatcaggaagagtgagttttaccgagacaagaagtttgagaaagtgaggggtcagaag
gaggatgccaatgttgaggttgaggccaacgagatggagcaggagcggcctgaggacgaa
ccactggagagggttcgtcaggatgagcagtcccaagaactggcccagagtggcaggaag
cagaatagcaactgccaggtgcttttggagcctgccaggtttggcctccgggagaatgcc
attgtgaacgtgaagcagtcacagatcttgcatccagtgaagacgtag

DBGET integrated database retrieval system