KEGG   Rattus norvegicus (rat): 114023
Entry
114023            CDS       T01003                                 

Symbol
Copb1
Name
(RefSeq) coatomer subunit beta
  KO
K17301  coatomer subunit beta
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    114023 (Copb1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    114023 (Copb1)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    114023 (Copb1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   114023 (Copb1)
SSDB
Motif
Pfam: Adaptin_N Coatamer_beta_C Coatomer_b_Cpla Cnd1 HEAT_2 HEAT MMS19_N DUF5578 AP4E_app_platf
Other DBs
NCBI-GeneID: 114023
NCBI-ProteinID: NP_542959
RGD: 620861
Ensembl: ENSRNOG00000057623
UniProt: P23514
Position
1
AA seq 953 aa
MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLM
TIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGST
LRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFENLIPDAPELIHDF
LVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPS
ERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLI
VLDRLVELKEHPAHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSSRNVEELVIVL
KKEVIKTNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLSDSNEAAAADV
LEFVREAIQRFDNLRMLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKEDIQSVMTEVR
RSLGEIPIVESEIKKEAGELKPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEDRP
PLRGFLLDGDFFVAASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSL
PKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRQSLSQMLSAKLEEEKLSQKKESEK
RNVTVQPDDPISFMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLT
GFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPH
DFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEF
RQMWAEFEWENKVTVNTNVTDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSI
FGEDALANVSIEKPVHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSL
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgaccgcagctgagaacgtgtgctatacgttaattaacgtgccaatggactcagaaccc
ccttctgaaatcagcttaaaaaatgacctggagaaaggcgatgtgaagtcaaagactgaa
gctttgaagaaagtgatcattatgattctgaatggggaaaagcttcctggactcctgatg
acgatcattcgtttcgtgctgcctcttcaggatcacaccatcaaaaagttgcttctggtc
ttctgggaaattgttccgaaaacaactccagatgggaggctcttacatgaaatgattctt
gtgtgtgatgcatacagaaaggatctccagcatcctaatgagtttattcgtggatctact
cttcgtttcctttgcaaattgaaggaagcagaattgctggaacctctgatgcctgctatc
cgtgcttgtttggaacatcgtcacagctatgttaggagaaacgctgttttggccatctac
accatctacagaaattttgaaaatcttatacctgatgctcctgagctgatacatgatttt
ctggtaaacgagaaggatgcaagctgcaaaagaaatgcatttatgatgctcattcatgca
gatcaggatcgagctttggattatttaagtacatgtattgatcaagttcagacatttgga
gacattctacagttggttattgttgaactaatttataaggtctgtcatgctaatccatca
gagagggcccgtttcattcgctgtatctataacttactgcagtcatctagtcctgctgta
aaatacgaagctgctgggacactggtgacactgtcaagtgctccaactgcaataaaggct
gctgctcagtgttacattgatttaattattaaggaaagtgataacaatgtaaagctcatt
gtcctggaccgattggtagaactaaaagagcatcctgctcacgagcgagtcctccaagat
ctggtcatggacatcctacgagtactgagtacaccagacctagaagtgcgcaagaaaacg
ctgcagttagcactggatcttgtctcatctaggaatgttgaagagttggttattgtcttg
aagaaggaagtaattaaaacaaataacgtgtctgagcatgaagacactgacaaataccga
cagcttctcgtgcgaacactgcattcctgctctgtccgatttccagatatggctgcaaat
gttattcctgtgctaatggaatttctcagtgacagtaatgaagcagcagctgctgatgtc
ttggagtttgtgcgtgaagccattcagcgctttgacaacctgagaatgctgattgttgag
aagatgctggaagtcttccatgctattaagtctgtcaagatttatcgaggagcactgtgg
atcctgggcgagtactgcagtactaaggaagacattcagagtgtgatgactgaagtccgc
aggtcccttggggagatcccaatcgtagaatcagaaataaagaaagaagctggcgagtta
aaaccagaagaagaaataactgttgggcccgttcagaaattggttacagagatgggcacc
tatgctactcagagtgcactcagcagctctagacctaccaagaaagaagaggacagacca
cccttgagaggattcctcctggatggagatttctttgttgctgcctcccttgccacaact
ctgaccaagattgcattacgctatgtagcattggttcaggagaagaaaaagcaaaactct
tttgttgctgaggctatgttgcttatggcaaccatccttcatttgggaaaatcctctctt
cctaagaagccaatcactgatgatgatgtagaccgaatttccctgtgcctcaaggtctta
tctgaatgctcacctttaatgaatgacatttttaataaggagtgcagacagtctctttcc
caaatgttgtctgccaaactcgaagaagagaaactatcccaaaagaaagaatctgaaaag
aggaatgtaacagtacagcctgatgaccccatttccttcatgcaactaactgctaagaat
gagatgaactgcaaggaggatcagttccagctgagtttgttggcagcgatgggtaacact
cagaggaaagaggcagcagaccccctggcgtccaaactcaacaaggtcactcagttgaca
ggtttctctgatccagtgtatgcagaagcttatgttcatgtcaatcagtatgatattgtc
ctggatgttcttgttgtaaaccaaaccagtgatactttgcagaactgcacattagagtta
gctactctaggggatctgaaactcgtggaaaaaccatctcctttgactcttgctcctcat
gactttgcgaatattaaagccaatgtcaaagtagcatcaacagaaaatggaataattttc
ggcaatatagtttatgatgtctctggagcagcaagtgacagaaactgtgtggtcctcagt
gacatccacattgacatcatggactatatccagcctgcaacttgcactgatgctgagttc
cgtcagatgtgggccgaatttgaatgggaaaataaagtgacagttaacaccaacgtgact
gacctgaatgattatttacagcacatcctcaagtccaccaacatgaagtgcctgactcca
gagaaggccctttctggctactgtggcttcatggcagccaacctatatgctcgctctata
tttggagaggatgcacttgcaaatgtcagcattgagaagccagttcaccagggaccagat
gctgctgttactggccatataagaattcgtgcaaaaagtcagggaatggccttgagcctt
ggagataaaatcaacctgtctcaaaagaagactagtctctaa

DBGET integrated database retrieval system