KEGG   Rattus norvegicus (rat): 114027Help
Entry
114027            CDS       T01003                                 

Gene name
Dao, Dao1
Definition
(RefSeq) D-amino-acid oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00260  Glycine, serine and threonine metabolism
rno00330  Arginine and proline metabolism
rno00472  D-Arginine and D-ornithine metabolism
rno01100  Metabolic pathways
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    114027 (Dao)
   00330 Arginine and proline metabolism
    114027 (Dao)
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    114027 (Dao)
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    114027 (Dao)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    114027 (Dao)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     114027 (Dao)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO ADH_zinc_N_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 114027
NCBI-ProteinID: NP_446078
RGD: 621138
Ensembl: ENSRNOG00000054962
UniProt: O35078
Position
12q16
AA seq 346 aa AA seqDB search
MRVAVIGAGVIGLSTALCIHERYHPAQPLHMKIYADRFTPFTTSDVAAGLWQPYLSDPSN
PQEAEWNQQTFDHLQSCLHSPNAEKMGLALISGYNLFRDEVPDPFWKSTVLGFRKLTPSE
LDMFPDYSYGWFNTSLLLEGKSYLSWLTERLTERGVKFIHRKVASFEEVVRGGVDVIINC
TGVWAGALQADASLQPGRGQIIQVEAPWIKHFILTHDPSLGIYNSPYIIPGSKTVTLGGV
FQLGNWSELNSVHDHNTIWKSCCQLEPTLKNARIMGELTGFRPVRPQVRLERERLRFGSS
SAEVIHNYGHGGYGLTIHWGCAMEAANLFGKILEEKNLSRMPPSHL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtggccgtgattggagcgggagtcatcggactgtctacagccctctgcattcat
gaacgttaccacccagcccaacctctgcacatgaagatctatgcggatcgcttcacgccg
ttcactaccagcgatgtggctgcgggactctggcagccttatctctctgaccccagcaac
ccgcaggaggcggagtggaaccagcaaactttcgatcaccttcagagctgcctccattct
ccaaacgctgagaaaatgggcttggccctaatctcaggctacaacctcttccgagacgaa
gtcccggaccctttctggaaaagcacagttctgggattccggaagctgacccccagcgag
ttggacatgttccctgattatagctatggctggttcaacacgagcctccttcttgagggg
aagagctacctatcatggctgactgagaggttaactgagaggggagtgaagttcatccat
cggaaggtggcatctttcgaagaggtggtgagaggaggcgtggatgtgattatcaactgc
accggggtgtgggccggggctctgcaagcagacgcctccctgcagccaggccggggccag
atcatccaggtggaggccccttggataaagcacttcatcctcacccatgatcccagcctt
ggcatctacaactctccatacatcatcccaggttccaagacagttacactcggaggtgta
ttccagctggggaactggagcgagctaaacagcgtccatgaccacaacaccatttggaag
agctgctgtcaactggagcccaccctgaagaatgcaagaatcatgggtgaactcactggc
ttccggccagtccgacctcaggtccggctagaaagagaacgccttcgctttggatcttca
agtgcagaggtcatccataactatggtcatggaggttacgggctcacgattcactggggt
tgtgcaatggaggcagccaacctctttgggaaaattctagaagaaaagaacttgtccagg
atgcctccatcccacctctga

DBGET integrated database retrieval system