KEGG   Rattus norvegicus (rat): 114031Help
Entry
114031            CDS       T01003                                 

Gene name
Fstl3, Flrg
Definition
(RefSeq) follistatin like 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Kazal_2 Kazal_1 FOLN
Motif
Other DBs
NCBI-GeneID: 114031
NCBI-ProteinID: NP_446081
RGD: 621811
Ensembl: ENSRNOG00000009311
UniProt: Q99PW7
Position
7q11
AA seq 256 aa AA seqDB search
MRPGALWPLLWGALVWAVGSVGAVMGSGDSVPGGVCWLQQGKEATCSLVLKTQVSREECC
ASGNINTAWSNFTHPGNKISLLGFLGLVHCLPCKDSCDGVECGPGKACRMLGGRPHCECV
SNCEGVPAGFQVCGSDGATYRDECELRTARCRGHPDLRVMYRGRCQKSCAQVVCPRPQSC
LVDQTGSAHCVVCRAAPCPVPPNPGQELCGNNNVTYISSCHLRQATCFLGRSIGVRHPGI
CTGGPKVPAEEEENFV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcctggggcactgtggccgctgctttggggagccctggtctgggcggtgggatcc
gtgggcgccgtgatgggctcgggggattctgtgccgggtggtgtgtgctggctccagcag
ggcaaggaggccacctgcagtctggtgctgaagacacaggtcagccgggaggagtgctgc
gcttccggcaacatcaacacagcctggtccaacttcacccacccgggcaataaaatcagc
ctgctaggattcctgggccttgtccactgcctaccatgcaaagattcttgcgacggagtg
gagtgcggccccggcaaggcgtgccgcatgttggggggccgtccacactgcgagtgcgtg
tccaactgcgagggggttcccgcgggcttccaggtctgcggctctgatggcgccacctac
cgggacgaatgcgaactgcgcaccgcgcgctgtcgcggacacccagacctgcgcgtcatg
taccgcggccgctgccaaaagtcctgcgctcaggtagtgtgcccgcgcccccagtcgtgc
cttgtggatcagactggcagcgcacactgcgtggtgtgtcgcgctgcaccctgcccagta
cctcccaaccctggccaagaactctgcggcaacaacaacgttacctacatctcgtcgtgt
cacttgcgccaggccacttgctttctgggccgttccattggagttcggcacccgggcatc
tgcacaggtggccccaaagtaccagcagaggaggaagagaacttcgtgtga

DBGET integrated database retrieval system