KEGG   Rattus norvegicus (rat): 114090
Entry
114090            CDS       T01003                                 

Gene name
Egr2
Definition
(RefSeq) E3 SUMO-protein ligase EGR2
  KO
K12496  early growth response protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04625  C-type lectin receptor signaling pathway
rno05161  Hepatitis B
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    114090 (Egr2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    114090 (Egr2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114090 (Egr2)
   05161 Hepatitis B
    114090 (Egr2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    114090 (Egr2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    114090 (Egr2)
SSDB
Motif
Pfam: DUF3446 zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-BED zf-C2HC_2 zf-H2C2_5 Zf_RING zf-C2H2_8
Other DBs
NCBI-GeneID: 114090
NCBI-ProteinID: NP_446085
RGD: 621608
Ensembl: ENSRNOG00000000640
UniProt: P51774
Position
20
AA seq 470 aa
MMTAKAVDKIPVTLSGFMHQLPDSLYPVEDLAAPSVTIFPNGELGGPFDQMNGVAGDGMI
NIDMTGEKRPLDLPYPSSFAPISAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGI
LQGVTPPASTTASSSVTSASPNPLATGPLGVCTMSQTQPELDHLYSPPPPPPPYSGCTGD
LYQDPSAFLSPPPTTSTSSLAYQPPPSYPSPKPAMDPGLIPMIPDYPGFFPSPCQRDPHG
AAGPDRKPFPCPLDSLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGGEGPRLPGSGSA
AVTATPYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRI
HTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQ
KERKSSAPSSSASAQSSASGPGGSQAGGSLCGNSAIGGPLASCTSRTRTP
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgatgaccgccaaggccgtagacaaaatcccagtaactctcagtggttttatgcaccag
ctgcctgacagcctctacccggtggaagacctcgccgccccgtcggtgaccatcttcccc
aatggtgaactgggaggcccctttgatcagatgaacggagtggctggagatggcatgatc
aacattgacatgaccggagagaagaggcccttggatctcccatatccgagtagcttcgct
cccatctctgcgcctagaaaccagaccttcacttacatgggcaaattctccattgaccct
cagtaccctggtgccagctgctacccagaaggcatcatcaatattgtgagtgcgggcatc
ttgcaaggggtcacccctccagcttcaaccacagcctcttccagcgtcacctctgcctcc
cccaacccactggccacgggacccctgggtgtgtgtaccatgtcccagactcagcctgaa
ctggaccacctctactctccaccaccacctcctcctccttattcgggctgtacaggagac
ctctaccaggatccttcagcattcttatcgccgccacccaccacttccacctcctctctg
gcctaccagccacctccttcctacccatcccccaagccggctatggacccaggtctcatt
cctatgatcccagactatcctggattttttccatctccgtgccagagagatccacatggc
gcggctggccctgatcgaaagccgttcccctgccctctggactccctgcgggtcccccct
ccgctcacgccactctccaccatccgtaattttactcttggggggcccagtgctggcgtc
acgggaccaggggcaagtggaggcggtgagggtccccgactgcctggcagtgggtctgca
gcagtgactgctaccccctacaatccgcaccacctgcctttaaggcccatcctgagacct
cgaaagtaccccaacaggcccagcaagacgccagtgcacgaaaggccgtacccctgccca
gcagagggttgcgacaggaggttctcacgctctgatgagctgaccaggcacatccgaatc
cacaccggtcacaagcccttccagtgtcggatctgcatgcgaaacttcagccgaagtgac
cacctcaccactcacatccgcacccacaccggggagaagccctttgcctgtgactattgt
ggccgtaagtttgcccggagtgacgaaaggaagcgccacaccaagatccaccttcgccag
aaggagaggaagagcagtgccccctcgtcatctgcatccgcccagtcttcagcctctggt
cctgggggctcgcaggccgggggcagcctgtgcggtaacagcgccattggaggaccactg
gcctcctgcacctctcggaccaggaccccgtga

KEGG   Rattus norvegicus (rat): 25148
Entry
25148             CDS       T01003                                 

Gene name
Egr3
Definition
(RefSeq) early growth response protein 3
  KO
K12497  early growth response protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04625  C-type lectin receptor signaling pathway
rno05161  Hepatitis B
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    25148 (Egr3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    25148 (Egr3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    25148 (Egr3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25148 (Egr3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    25148 (Egr3)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 DUF3446 zf-C2H2_4 zf-C2HC_2 zf-BED zf-H2C2_5 zf-C2H2_6 zf-C2H2_8
Other DBs
NCBI-GeneID: 25148
NCBI-ProteinID: NP_058782
RGD: 2545
Ensembl: ENSRNOG00000017828
UniProt: P43301
Position
15
AA seq 387 aa
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVAHYTQMATENVMDIGLT
NEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTTTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAK
PALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIH
PGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHT
GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKE
KKSEKGGAPSASSAPTVSLAPVVTTCA
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgaccggcaaactcgccgagaagctgccggtgaccatgagcagtttgctaaatcaattg
cctgacaatctgtaccccgaggagatccccagcgcgctcaacctcttctccggcagcagt
gactcggtagcccattacactcagatggctacagagaatgtgatggacatcggtctgacc
aacgagaagcccaatccggaactctcttattcgggctctttccagccagccccaggcaac
aagaccgtgacctacttgggaaagttcgctttcgactctccttccaactggtgccaggac
aacatcattagcctcatgagtgccggcatcttgggggtgcccccggcctcaggggcgctc
agtacgcagacgaccacggctagcatggtgcagcctcctcagggagacgtggaggccatg
tatccggcgctgcccccctattccaactgcggcgacctctactcggagccggtgtctttc
cacgacccccaggggaacccagggctcgcctattccccccaggattaccaatcggccaag
ccggccttggacagcaatcttttccccatgattcctgactacaacctgtatcaccacccc
aacgacatgggctccattccagaacacaagcccttccagggcatggaccccattcgggtc
aacccaccccctattacccctctggagaccatcaaggccttcaaagacaagcagatccac
ccgggcttcggcagcttgccccaaccgccgcttactctcaagcccatccggccccgcaag
taccccaatcggcctagcaagaccccactccacgagcggccccacgcgtgtcccgcggaa
ggctgtgaccggcgtttcagccgctcggacgagctgacccggcacctgcgcatccacacg
ggccacaagcccttccagtgtcggatctgcatgcgcagcttcagccgcagcgaccacctc
actactcacatccgcacgcacaccggggagaagccctttgcctgtgagttctgtgggcgc
aagtttgcgcgcagcgacgagcgcaagcgccacgccaagatccacctcaagcaaaaggag
aagaagtcggagaaagggggtgcgccctctgcatcctcggcgcccaccgtgtccctggcc
cctgtggtcaccacctgcgcctga

DBGET integrated database retrieval system