KEGG   Rattus norvegicus (rat): 114095
Entry
114095            CDS       T01003                                 

Gene name
Stxbp3, Munc18-c
Definition
(RefSeq) syntaxin binding protein 3
  KO
K15301  syntaxin-binding protein 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    114095 (Stxbp3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    114095 (Stxbp3)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    114095 (Stxbp3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114095 (Stxbp3)
SSDB
Motif
Pfam: Sec1 SGT1 DUF5797 T6PP_N
Other DBs
NCBI-GeneID: 114095
NCBI-ProteinID: NP_446089
RGD: 619968
Ensembl: ENSRNOG00000020392
UniProt: Q99PV2
Position
2q34
AA seq 593 aa
MAPPVTERGLKSVVWRKIKTTVFDDCRKEGEWKIMLLDDFTTRLLSSCCKMTDLLEEGVT
VIENIYKNREPVRQMKALYFISPTPKSVDCFLRDFGSKSEKKYKAAYIYFTDFCPDSLFN
KIKASCSKSIRRCKEINISFIPHESQVYTLDVPDAFYYCYSPDPSNAGRKEAVMEAMAEQ
IVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDENGLIKGKTQSQLLIIDR
GFDPVSTVLHELTFQAMAYDLLPIEKDTYKYKTDGKEKEAVLEEDDDLWVRVRHRHIAVV
LEEIPKLMKEISSTKKATEGKTSLSALTQLMKKMPHFRKQISKQVVHLNLAEDCMNKFKL
NIEKLCKTEQDLALGTDAEGQRVKDSMLVLLPVLLNKNHDNCDKIRAVLLYIFGVNGTTE
ENLDRLIHNVKIEDDSDMIRNWSHLGVPIVPPSQQAKPPRKDRSAEETFQLSRWTPFIKD
IMEDAIDNRLDSKEWPYCSRCPAVWNGSGAVSARQKPRTNYLELDRKNGSRLIIFVIGGI
TYSEMRCAYEVSQAHKSCEVIIGSTHILTPRKLLDDIKMLNKSKDKVSFLKDE
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggcgccgccggtgacggaacgggggctgaagagcgtcgtgtggcggaaaataaaaaca
acagtgtttgatgactgccggaaagaaggcgagtggaagatcatgctgttggatgacttc
accaccagacttctgtcatcgtgctgcaaaatgacagaccttctagaagagggtgtgaca
gttatagagaatatttataagaatcgtgaacctgtcagacaaatgaaagctctttatttt
atctctccaacaccaaaatctgtagattgtttcttgcgagattttggaagtaaatctgag
aaaaagtacaaagcagcatatatctacttcactgacttttgtcccgacagtctctttaac
aagattaaagcatcttgctccaaatcaataagaagatgtaaggaaataaatatttccttt
attccacatgaatctcaggtttacactcttgatgtaccagacgcgttctattactgttac
agtccagaccctagcaatgccggcagaaaagaagcagtcatggaagcaatggctgagcag
attgtgaccgtgtgtgccactctggatgagaaccctggagtgaggtataagagtaaacct
ctagataatgccagtaagcttgcacagctggttgaaaagaagcttgaagactactacaaa
attgatgagaacggcctaataaagggtaaaactcagtcccagctcttaataattgaccgt
ggctttgaccctgtgtccactgtcctgcatgaactgacctttcaggcaatggcatatgat
ctactaccaattgagaaagatacatacaaatataaaacagatgggaaagagaaggaggca
gttcttgaagaagatgatgacctgtgggtgcgggttcggcaccggcacatcgcggttgtt
ttggaggaaattccaaagcttatgaaggaaatttcatcaacaaagaaagctacagagggg
aagacctcactcagcgcgcttacccagctgatgaaaaagatgccgcacttccggaaacag
atctcgaagcaagtcgtccatcttaacctagctgaagactgcatgaataagtttaagctg
aatattgagaagctctgcaaaactgagcaggacctggcacttggaacagatgcggaaggc
cagcgggtaaaggactccatgctggtgctcctcccagtgctgctcaacaaaaaccacgac
aactgcgacaaaatacgggcagtcttgctctacatcttcggtgttaatggaaccactgaa
gaaaacctggacagactgatccacaatgtaaagatagaagatgacagtgatatgattcgg
aactggagtcacctcggtgttcccattgttcccccatcccaacaagccaaaccaccaaga
aaagatcggtctgccgaagagacttttcagctttctcgatggacaccttttatcaaagat
atcatggaggatgccattgataatagattggattccaaagaatggccatactgttcccgg
tgcccagcggtgtggaatggctctggagctgtaagtgctcgccagaaacccagaaccaac
tatttagagctggaccggaaaaatggctcgaggctgattatttttgtaattggaggaatt
acatactctgagatgcgttgtgcttatgaagtttctcaggcacataaatcctgtgaagtt
attattggttccacacatattttaacacccagaaagctgctggatgacataaaaatgctg
aataaatccaaggataaagtttcctttcttaaggatgagtag

DBGET integrated database retrieval system