KEGG   Rattus norvegicus (rat): 114102Help
Entry
114102            CDS       T01003                                 

Gene name
Cdh23, W
Definition
(RefSeq) cadherin-related 23
  KO
K06813  cadherin 23
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    114102 (Cdh23)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    114102 (Cdh23)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   USH complex and associated proteins
    114102 (Cdh23)
Cell adhesion molecules [BR:rno04515]
 Cadherins
  Major cadherins
   114102 (Cdh23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_2 Cadherin_3
Motif
Other DBs
NCBI-GeneID: 114102
NCBI-ProteinID: NP_446096
RGD: 619760
UniProt: P58365
Position
20q11
AA seq 3317 aa AA seqDB search
MRHPPVTWCAMLWLLMLVSGSWGQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDM
DNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNI
QVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSQFFAI
DSARGIVTVIRELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLP
YSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYISGALTLNGLLD
RENPLYSHGFILTVKGTELNDDRSPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITEL
AQVGFALPLFIQVVDKDEGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYE
TVDRYDFDLFANESVPDHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTV
LATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTVIARDGGGEE
TTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNLITYSIVN
ASAFGSYFDISVYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVF
DENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEGSSQFRIN
ARSGEITTTSLLDRETKAEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAP
YYINLVEMTPPDSDVTTVVAVDPDLGKNGTLVYSIQPPNKFYSLNSTTGKIRTTHVMLDR
ENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLEG
TPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTSGVVTTTAELDRERIAEYQ
LRVVASDAGTPTKSSTSTLTIRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDN
DVGLNAELSYFITAGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNVPVGKRR
TGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQLKATDADEGEFGRVWYRIL
HGNHGNNFRLHVSSGLLVRGPRPLDRERNSSHVLMAEAYNHDLGPMRSSVRVIVYVEDVN
DEAPVFTQQQYNRLGLRETAGIGTSVIVVRATDRDTGDGGLVNYRILSGAEGKFEIDEST
GLIVTVDYLDYETKTSYLMNVSATDGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVI
MENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKG
DFYTLTVVADDGGPKVDSTVKVYVTVLDENDNSPRFDFTSDSAISVPEDCPVGQRVATVK
ARDPDAGSNGQVVFSLASGNIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKIVASDR
GTPPRKKDHILQVTILDVNDNPPVIESPFGYNVSVNENVGGGTSVVQVRATDRDIGINSV
LSYYITEGNEDMTFRMDRISGEIATRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYV
TIVDENDNAPVFQQPHYEVVLDEGPDTVNTSLITVQALDLDEGPNGTVTYAIVAGNIINT
FRINRRTGVITAAKELDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVP
TFPRDYEGPFDVTEGQPGPRVWTFLAHDRDSGPNGQVEYSVVDGDPLGEFVISPVEGVLR
VRKDVELDRETIAFYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNITISE
NSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIPEY
RLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLN
GPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGVIIDREAFSPPFLELLLL
AEDVGQLNGTAYLFITILDDNDNWPTFSPPAYTVHLLENCPPGFSVLQITATDEDSGLNG
ELVYRIEAGAQDRFLIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTATVTI
LIDDINDSRPEFLNPIQTVSVLESTEPGTVIANVTAIDLDLNPKLEYHILSIVAKDDTDR
LVPDQEDAFAVNINTGSVIVKSPLNRELVATYEVTLSVIDNASDLPERSVSVPNAKLTVN
ILDVNDNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTLLDLIPPG
YVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIF
DQLSYQEAVFEDVAVGTVILRVTATDADSGNFALIEYSLVDGEGKFAINPNTGDIYVLSS
LDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENE
PAGTSVITMLATDQDEGSNGQLTYSLEGPGMEAFSVDMDSGLVTTQRPLQSYERFNLTVV
ATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPLRSNVYEVYATDKDE
GLNGAVRYSFLKSTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPY
ETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNA
IVYYFIAAGNEDKNFHLQPDGRLLVLRDLDRETEAIFSFIVKASSNRSWTPPRGPSPALD
LLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGNNSLVF
YGILAIHYFRALANDSEDVGQVFTMGSVDGILRTFDLFMAYSPGYFVVDIVARDLAGHND
TAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFHVDMKGRV
NFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAISVQLPDDM
SALQMAIIVLAILLFLAAMLFVLMNWYYRTIHKRKLKAIVAGSAGNRGFIDIMDMPNTNK
YSFDGANPVWLDPFCRNLELAAQAEHEDDLPENLSEIADLWNSPTRTHGTFGREPAAVKP
EDDRYLRAAIQEYDNIAKLGQIIREGPIKLIHTDLEEEPGDHSPGQGSLRFRHKPPTELK
GPDGIHIVHGSTGTLLATDLNSLPEDDQKGLDRSLETLTASEATAFERNARTESAKSTPL
HKLRDVIMESPLEITEL
NT seq 9954 nt NT seq  +upstreamnt  +downstreamnt
atgaggcacccccctgtcacttggtgtgccatgctctggcttctcatgctggtgtccgga
tcctggggccaggtgaaccgactaccttttttcaccaatcacttctttgacacgtacctg
ctcatcagtgaagacactcctgtgggttcttctgtgacccagttgctggcccgagacatg
gacaatgaccccttggtgttcggcgtgtctggggaggaggcctcccgcttctttgccgtg
gagcctgacacgggtgtggtgtggctccggcagccactggacagagagactaagtctgag
ttcacagtggagttctccgtcagtgaccaccaaggggtgatcacaaggaaggtgaatatc
caagttggagacgtgaacgacaatgcacccacattccacaaccagccctacagcgtgcgc
atccctgaaaacacaccagtggggacacccatcttcatcgtcaacgccactgatcctgac
ctgggcgcagggggcagtgtcctctactccttccagcccccctctcagttcttcgccatc
gacagtgcccgaggcatagtcaccgtgatccgggagctggactatgaggtcacgcaggcg
taccagctcacagtcaatgccacggatcaagacaagaccagacctctgtctacattagcc
aacctggccatcatcatcacggacgtacaagacatggaccccatcttcatcaatctgccc
tacagtaccaacatctatgagcactctcccccgggcacgactgtgcgggtgatcactgct
gtggatcaggataagggacggccccgggggattggctacactattgtctcagggaatacg
aacagcatctttgccctggactacatcagcggggctctcaccctgaatggcctgctggac
cgggagaaccccctgtacagccacggcttcatcctgacggtgaagggcactgagctgaat
gatgatcgtagtccgtctgacgccaccgtcaccacgaccttcaacatcctggttatcgac
atcaatgacaatgccccggagttcaacagctctgagtacagcgtggccattactgagctg
gcacaggtcggctttgccctccctctcttcatccaggtggtggacaaggatgagggtcta
aacagcatgttcgaggtgtacctggtgggcaacaactcccaccacttcatcatctcccca
acctccgtccaggggaaagcagacatccgcatccgagtggcaatcccactggactacgag
accgtggacagatacgactttgacctctttgccaacgagagcgtacccgaccacgtgggc
tacgccaaggtgaagattacgctcattaatgaaaatgacaaccggcccatcttcagccag
cccctctacaatgtcagcctgtatgaaaacatcaccgtggggacctccgtgctgacagtc
ctggcaacagacaatgacgtgggcacttttggggaagtcaactacttcttcagtgatgac
cccgacaggttctcactggacaaggacacaggcctcatcatgcttatagcccggctggac
tatgagcttatccagcgtttcaccttgactgtcattgcccgggatggtggcggtgaggag
accacaggccgggtccggatcaatgtgctggatgtcaacgacaatgtgcccaccttccag
aaggatgcctacgtgggtgctctgagggagaatgagccatctgtcacacagctggtgcgg
ctcagggcaacagatgaagactcccctcccaacaacctgatcacctacagcatcgtcaac
gcgtccgccttcggcagctactttgacatcagtgtgtatgaaggctatggagtgatcagt
gtgagccgcccactggattatgaacagatacccaatgggctgatatacctaaccgtcatg
gccaaggatgctggcaaccctccgctctacagcaccgtccctgtcaccattgaggtgttt
gatgagaacgacaaccctcccaccttcagcaagcctgcctacttcgtgtctgtggtggag
aacatcatggcaggagccacagtgttgttcctaaatgccacggacctggaccgctcccgg
gagtatgggcaggagtctatcatctattcgctggagggctcctcacagttccgcatcaat
gcccgctctggagaaatcaccaccacgtctctgctggaccgagagaccaaagctgaatac
atactcattgtgcgtgctgtggatgggggtgtgggccacaaccagaaaactggcattgcc
acagtgaatgtcaccctcctagacatcaatgacaaccaccccacctggaaggatgctccc
tactacatcaacctggtggagatgacgcctccagactctgatgtgaccacggtggtagct
gtggacccagatctggggaagaatggcaccctggtgtacagcatccagccccccaacaag
ttctatagtctgaacagcaccacaggcaagatccgcaccacccacgtcatgctggaccga
gagaaccctgaccccgtggaggcggagctcatgcgcaagatcattgtctctgtcacggac
tgtggtagaccccccctgaaggccaccagcagtgccacagtctttgtgaacctcttggat
ctcaatgacaacgaccccaccttccagaacctgccttttgtggctgaggttcttgagggc
acccctgcaggggtctctgtctaccaagtggtggccatcgatctggatgagggcctgaat
ggactggtgtcctatcgcatgcaagtgggcatgccccgcatggactttgtcatcaacagc
accagtggtgtggtcacgaccacagccgagttggaccgggagcgcatcgccgagtaccag
ctgcgggtggtggccagcgatgcgggcacacctaccaagagctccaccagcaccctcacc
atccgcgtgttggatgtgaacgatgagacgcccaccttcttccctgccgtgtacaacgtg
tccgtgtctgaggatgttccccgtgagttccgtgtggtctggctgaactgcacagacaat
gacgtcggtctcaatgcggaactcagctacttcatcacagcgggaaatgtggacgggaag
tttagtgtgggctaccgtgatgccgtggtgagaaccgtggtcggcctggaccgtgagacc
acagctgcgtacacactggtgctggaggctatcgacaatgtccctgtaggcaagcggcgc
acaggtacggccaccgtgtttgtcacagttctggatgtgaacgacaaccggcccatcttc
ctgcaaagcagctatgaggccagtgtcccagaagacatccccgagggccacagcattgtg
cagctgaaagccacagatgcagacgagggcgagtttggacgtgtctggtaccgcatcctc
catggtaaccatggcaacaacttccgcctccacgtcagcagcgggctcctggtgcgaggc
ccaaggcccctggacagggagcgaaactcgtcccatgtgctgatggcagaagcctacaac
cacgacctggggcccatgcggagctcggtcagggtgatcgtgtatgtggaagatgtcaac
gatgaggcccctgtgttcacacagcagcagtacaatcgcctgggccttcgagagacagca
ggcatcggcacctcagtcatcgttgtccgagccaccgacagagacactggggacggtggc
ctggtgaactaccgcatcctgtcgggcgcagagggcaagtttgagattgacgagagcaca
gggctcatcgtgacggttgactatctggactacgagaccaagaccagctatctgatgaac
gtgtcagccacagacggtgcaccccccttcaaccagggcttctgcagcgtctacgtgaca
cttctcaacgagctggatgaggctgttcagttctccaatgcctcctatgaggcagtcatc
atggagaatctggctctggggaccgagatcgtgcgggtgcaagcctattccattgataac
ctcaatcaaatcacctaccgctttgacgcctataccagcgcccaggccaaagccctcttc
aagatagatgccatcacgggcgtgatcacagtcaaaggcttggtcgacagggagaagggc
gacttctacacattgacggtcgtggcagatgatggtggccccaaggtggactctactgtg
aaggtctacgtcactgttctggatgaaaatgataacagcccacgctttgacttcacctct
gattcggccatcagtgtgcctgaggactgccctgtaggccaacgagtagccactgtcaag
gcccgggaccctgatgctggcagcaacggtcaggtggtcttctccctggcctccggtaac
attgctggggcctttgagattatcaccagcaatgactccattggtgaagtgtttgtggct
aagcccctggacagggaggaactggaccactacatcctcaagattgtagcttctgaccgt
ggcactcctccacggaagaaagaccacatcttacaggtgaccattctggatgtcaatgac
aaccctccagtgattgagagcccctttgggtacaacgtcagtgtgaatgagaatgtgggt
ggaggcacctcagtagtccaggtgagagccaccgaccgtgacatcgggatcaacagcgtc
ctgtcctattatatcacggagggcaatgaggacatgactttccgtatggaccgcatcagc
ggtgagattgctacacggcctgctccacccgaccgtgagcgccagaacttctaccacctg
gtggtcactgtggaagacgagggcacccccacactatcggctaccacccatgtgtacgtg
actatcgtggacgagaatgacaatgctcctgtgttccagcagccacattatgaggtggtg
ctggacgagggcccggacacagtcaacaccagcctcatcaccgtccaggcgctggacctg
gatgagggcccgaatggcactgttacctatgccattgtggcaggcaatatcatcaatacc
ttccgaatcaacaggcgcacgggtgtcattactgctgccaaggagctagactatgagatc
agtcatggccgctataccctgattgtcactgccacagaccagtgtcccatcttgtcccac
cgcctcacctctactaccacagtgctcgtgaacgtgaatgacatcaatgacaatgtgccc
actttccctcgggactatgaaggaccattcgatgtcactgagggccaaccagggcccaga
gtgtggacattcctggcccatgaccgggactccggtcccaatgggcaggtggagtacagt
gttgtggatggagacccactgggggagtttgtgatctctcctgtggagggtgtgctgagg
gtccggaaggatgtagaactggatcgggagaccatcgccttctacaatctgaccatctgt
gcccgagacaggggggtgccgccactcagctccacgatgctggtgggaatccgagtgctg
gacatcaatgacaatgacccggtgctgttgaatcttcccatgaacatcaccatcagtgag
aacagcccggtctccagcttcgtcgcccacgtcctggccagcgacgctgacagtggctgc
aatgccctgctcaccttcaacatcaccgctggcaaccgggagcgggccttcttcatcaat
gccacgacagggatcgtcactgtcaaccggcccctggaccgagagcgcatcccagaatac
aggctgaccgtttctgtaaaggacaacccagagaacccacgcatagccaggaaggatttt
gacttactgctggtctctctggctgatgaaaatgacaaccaccccctcttcactgagggc
acgtaccaggccgaggtgatggagaactctcctgctgggacacctctcaccgtgctcaat
ggacctatcctggccctggatgctgatgaagatgtgtacgctgtagtcacgtatcaactc
ctgggcactcacagcgacctgtttgttattgacaatagcacgggcgtggtgactgtgagg
tccggggtcatcatcgaccgggaggccttctcacccccattcctggagttgctgctgttg
gctgaggacgtgggacaactcaatggcacggcctacctgttcatcactatcctagatgac
aatgacaactggcccaccttcagtcctcctgcttacactgtccacctgctggagaactgc
ccaccaggattctcagtccttcagatcacagccacagatgaggacagcggcctcaatggg
gagctggtctaccgaatagaagccggggctcaggaccgcttcctcatccatccagtcaca
ggagtcatccgtgttggcaatgccaccattgacagagaagagcaggaatcctacaggctg
acggtggtggccaccgaccggggcactgttcccttgtcgggcacagccaccgtcaccatc
ctgatcgatgacatcaatgactcccgccctgagttcctcaaccctatccagacagtgagc
gtgctggaatccacagagccaggcactgtcattgctaacgtcactgccatcgacctcgac
ctcaaccccaaactggagtatcacatccttagcatcgtggccaaggacgacactgaccgc
ctggtgcctgaccaggaagatgcctttgctgtgaatatcaatacagggtccgtgatagtg
aagtcccctctgaaccgcgagctggttgctacctatgaggtcacgctctcagtaatcgac
aatgccagcgacctcccagagcgttctgtcagtgtgccaaacgccaagctcacggtcaac
atcctggatgtcaatgacaatacaccgcagttcaagccctttggaatcacctactacaca
gagcgggtcctggagggggccaccccaggcacaacgctcattgctgtggccgccgttgat
cccgacaagggccttaacgggctgatcacctacaccctgctagacctcatacccccaggc
tatgtccagctcgaagactcttcagcagggaaggtcatcgccaaccgtacggtggactac
gaggaggttcactggcttaacttcaccgtgagggcctcagacaatgggtccccaccccgg
gcagctgagatccctgtctacctggaaattgtagacattaatgacaacaaccccatcttt
gatcagctctcctaccaggaggctgtttttgaggatgtagctgtgggcacggtcatcctg
agggttacagctacggatgctgactcaggcaactttgctctcatcgagtacagcctggtg
gatggagagggcaaatttgccatcaaccccaacactggtgacatctatgtgctgtcctct
ctggaccgagagaagaaggaccactacatcctaactgctttggccaaagacaaccctggc
gatgtggccagtaaccgtcgcgagaactcggtgcaggtggtgatccgagtacttgatgtc
aatgactgtcggcctcagttctccaagccacagttcagcacaagtgtgtacgagaatgag
ccagcaggtacttcagtcatcaccatgctggccactgaccaggacgagggctctaatggc
cagctgacctactctcttgagggtcccggaatggaggctttctctgtggacatggactcg
ggcctggtgaccacgcagcggccactacagtcctatgagaggttcaacctgaccgtagtg
gctacagatggtggggagcccccactctggggcaccacaatgctcctagtggaagtcatc
gatgtcaatgacaaccgccccgtcttcgtgcgcccacccaatggcaccattctgcacatc
aaagaggagatcccgctacgttccaatgtgtatgaagtctatgctacagacaaggatgaa
ggcctcaacggggcagtacgctacagcttcctgaagtcaacaggcaaccgtgactgggag
tacttcaccatcgacccaattagtggcctcatccagacagcgcagcgcctggaccgtgag
aagcaggcagtgtacagtctcatcttggtggccagcgacctgggccagccagtgccatac
gagacgatgcagccattgcaggtggccctggaggacatcgatgacaatgagcccctcttt
gtgaggcctcctaagggaagccctcagtaccaactgctaacagtgcctgaacactccccc
cgtggcacccttgtgggcaacgtgacaggcgcggtggacgcagatgaaggtcccaatgcc
attgtgtactacttcattgcagctggtaacgaggacaagaatttccacctacaacctgac
ggacgcctgctagtgcttagagacctggatcgggagacggaagccatcttctccttcatt
gtcaaggcgtccagcaatcgcagttggacccctccccgaggaccctccccagccctcgat
ctgctgaccgatctcaccctgcaggaggtgcgcgttgtgctggaggacatcaatgaccaa
ccgccacgcttcaccaaggctgagtataccgcaggagtggccaccgacgccaaggtaggc
tcggagttgatccaggtgctggccctggatgcagacattggcaacaacagcctggtcttc
tatggcattctggctatccactacttccgggccctggccaatgactccgaggatgtgggt
caggtcttcaccatggggagtgtggacggcatcctgcgtacctttgacctcttcatggcc
tacagccctggctactttgtggtagacatcgtggcccgagacctggccggtcacaacgat
acagccatcattggcatctacatcctgagggatgaccagcgcgttaagatagtcatcaac
gagatcccagaccgtgtgcgtggctttgaggaggagttcattcgcctgctgtccaacatc
acaggcgccatcgtcaacactgatgacgtgcagttccatgtggatatgaaaggaagagtg
aattttgcacagacagagctgctcatccacgtggtcaaccgcgacacgaaccgcatcctg
gatgtggacagggtcatccagatgattgatgagaacaaggaacaacttcgaaacctcttc
cggaactacaatgtactggacgtgcagcctgccatctctgtccagctgccagacgacatg
tctgccctgcagatggccatcattgtcctggccatccttctcttcttggctgccatgctc
tttgtcctcatgaactggtactacaggaccatacacaagagaaagctaaaggccattgtg
gctggttctgctgggaaccgtggcttcattgacatcatggacatgcccaataccaacaaa
tactccttcgatggagccaaccctgtgtggctggaccccttctgccggaacctggagctg
gctgcacaggctgaacacgaggatgacctccctgagaacctgagtgagatcgcagacctg
tggaacagccccacccgcacccatggaacttttggacgtgagcccgcggcagtcaaacct
gaagatgacagatacctgcgggcagccatccaggagtatgacaacatagccaagctgggt
cagatcattcgagaaggacctattaagctgatccacactgacctggaggaggagcctggc
gaccacagcccaggccagggcagcctccgtttccgacacaagccacccacggaactcaag
gggccagatggaatccacatagttcacggtagcacgggcacactgctggccactgatctc
aacagcttgcctgaggacgaccagaaggggctagaccgctcactggagactctgacagcc
tctgaagccactgcctttgaacgcaatgcccgcaccgagtcggccaagtccacccctctg
cataagcttcgagacgtcatcatggagagccccctggaaatcacggaactgtga

DBGET integrated database retrieval system