KEGG   Rattus norvegicus (rat): 114104
Entry
114104            CDS       T01003                                 

Gene name
Asah2
Definition
(RefSeq) neutral ceramidase
  KO
K12349  neutral ceramidase [EC:3.5.1.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    114104 (Asah2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    114104 (Asah2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     114104 (Asah2)
SSDB
Motif
Pfam: Ceramidase_alk Ceramidse_alk_C Pga1
Other DBs
NCBI-GeneID: 114104
NCBI-ProteinID: NP_446098
RGD: 69410
Ensembl: ENSRNOG00000012196
UniProt: Q91XT9
Position
1
AA seq 761 aa
MAKRTFSSLEAFLIFLLVMMTAITVALLTLLFVTSGTIENHKDSGNHWVSTTQGPTTTQS
SPTTQTPTTQTPDLPPSQNFSGYYIGVGRADCTGQVSDINLMGYGKNGQNAQGLLTRLFS
RAFILADPDGSNRMAFVSVELCMISQRLRLEVLKRLQSKYGSLYRRDNVILSATHTHSGP
AGFFQYTLYILASEGFSNRTFQYIVSGIVKSIDIAHTNLKPGKVLINKGNVANVQINRSP
SSYLQNPPSERARYSSDTDKEMVVLKLVDLNGEDLGLISWFAVHPVSMNNSNHLVNSDNM
GYAAYLFEQEKNRGYLPGQGPFVAGFASSNLGDVSPNILGPHCVNTGESCDNDKSTCPSG
GPSMCMASGPGQDMFESTHIIGRVIYQKAKELHASASQEVTGPVLTAHQWVNMTDVSVQL
NATHTVKTCKAALGYSFAAGTIDGVSGLNITQGTTEGNLFWDTLRDQLLGKPSEEIIECQ
KPKPILIHTGELTKPHPWQPDIVDIQIVTLGSLAIAAIPGEFTTMSGRRLREAVKKEFAL
YGMKDMTVVIAGLSNVYTHYITTYEEYQAQRYEAASTIYGPHTLSAYIQLFRALAKAIAT
DTVANMSSGPEPPFFKNLIGSLIPNIADRAPIGKQFGDVLQPAKPEYRVGEVVEVVFVGA
NPKNSAENQTHQTFLTVEKYEDSVANWQIMHNDASWETRFYWHKGVLGLSNATIHWHIPD
TALPGVYRIRYFGHNRKQELLKPAVILAFEGISSPFEIVTT
NT seq 2286 nt   +upstreamnt  +downstreamnt
atggcaaagcgaaccttctcctccttggaggcgttcctcattttccttctggtaatgatg
acggccatcacagtggcccttctcaccctcttgttcgtcaccagtgggaccatcgaaaac
cacaaagattcagggaatcactgggtttcaaccacccagggccccacaaccacccagtcc
tctccaaccacacaaactccaaccacacaaactccagacctccctccctctcagaacttc
agtggctactacattggtgttgggcgagctgactgcaccggacaagtgtcagatatcaat
ttgatgggctatggcaaaaatggccagaacgcacagggtctcctcaccaggctgttcagc
cgcgcttttatcttggcggatccagatgggtcaaatcgaatggcatttgtgagcgtggaa
ctatgcatgatttcccaacgactcaggttggaggtcttgaagagactacagagtaaatat
ggctctctgtatcgaagagacaacgttatcctgagtgccactcacactcactctggccca
gcaggatttttccaatatacactctatatacttgccagcgagggattcagcaaccggacc
tttcagtacatagtctctgggatcgtgaagagcattgatatagcacacacaaatcttaaa
ccgggcaaagtccttatcaacaaaggaaatgttgctaatgtgcagatcaaccgcagtccc
tcctcttaccttcagaatccaccttcggagagagcaaggtattcttccgacacggacaag
gaaatggtcgtcttgaaactggtggatttgaatggagaagacttgggccttatcagctgg
tttgccgtccaccccgtgagcatgaacaacagtaaccacctcgtcaacagtgacaatatg
ggctacgcggcttaccttttcgagcaagaaaagaacagaggctatctgcctggacaggga
ccattcgtagcaggctttgcttcatcaaatctcggagacgtgtcgcccaacattcttggc
ccacattgtgtcaacacaggggagtcttgtgacaacgacaaaagcacctgtcccagtggt
gggcctagcatgtgcatggccagtggacccggacaagatatgtttgagagcacacacatt
ataggacgggtcatctatcagaaagccaaggagctgcatgcctctgcctcccaggaagtg
accggcccagtgctcacagctcaccagtgggtgaacatgacggatgtgagcgtccaactc
aatgccacacacacagtgaagacgtgtaaagccgccctgggctacagttttgccgcaggc
acaattgatggagtttcgggcctcaatattacacagggaacaacagaagggaatctattt
tgggacactcttcgggaccagctcttgggaaaaccatctgaagaaatcatagaatgccag
aaacctaaaccaatcctaatccacacgggagagctgacaaaacctcatccttggcaacca
gatattgttgatattcagatcgttactcttggttcgttggccatagctgctatccctggg
gaatttacaaccatgtcaggtcgaagacttcgtgaggcagttaaaaaagaatttgcactt
tatgggatgaaggatatgactgtcgttatcgcagggctgagcaatgtttatacccattac
attaccacatatgaagaataccaggctcagcggtatgaggcagcatctacgatttatgga
ccacacaccctgtctgcgtacatccagctcttcagagcccttgctaaggccattgctacg
gatacagtagccaacatgagcagcggtcctgagcctccattcttcaaaaacctgataggt
tcacttattcctaatattgcggatagagcaccaataggcaaacaatttggggatgtcctg
cagccagcaaaacctgaatacagagtgggagaagtggttgaagttgtctttgtaggcgct
aacccaaagaattcagcagaaaaccagacccatcaaaccttcctcactgtggagaaatac
gaggactctgtagccaactggcagataatgcataacgatgcctcctgggagacgagattt
tattggcacaagggagtactgggtctgagcaatgcaacaatacattggcatattccagat
actgccctccctggagtctacagaatcagatattttggacacaatcggaagcaggaactt
ctaaagcctgctgtcatactagcatttgaaggaatttcttccccttttgaaattgtcact
acttag

KEGG   Rattus norvegicus (rat): 301118
Entry
301118            CDS       T01003                                 

Gene name
Acer1
Definition
(RefSeq) alkaline ceramidase 1
  KO
K01441  alkaline ceramidase [EC:3.5.1.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    301118 (Acer1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    301118 (Acer1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     301118 (Acer1)
SSDB
Motif
Pfam: Ceramidase CitMHS
Other DBs
NCBI-GeneID: 301118
NCBI-ProteinID: NP_001100345
RGD: 1588582
Ensembl: ENSRNOG00000047368
UniProt: M0R603
Position
9
AA seq 273 aa
MYAPSTRAKMSSIFAYQSSEVDWCESNFQHSELVAEFYNTFSNVFFLIFGPLMMFLMHPY
AQKRSWGIYGVSVLFMVIGLFSMYFHMTLSFVGQLLDEISILWLLASGYSVWLPRCYFPK
FIKGSRFYFSCLVIMTTIISTFLTFVKPTVNAYALNSIAIHILYIVRKEYKKTSNRDLRH
LIAVSVILWAAALTSWVSDRVLCSFWQRIQFFYLHSIWHVLISITFPYGIVTMALVDAKY
EMPDKTLKVHYWPRDSWLIGLPYVEIQENDKNC
NT seq 822 nt   +upstreamnt  +downstreamnt
atgtatgcaccgagcaccagagcaaagatgtccagcatctttgcctatcagagctctgag
gtggattggtgtgagagtaatttccagcactcggagttggtggccgagttctacaatacg
ttcagcaatgtgttcttcctcatctttggacccctcatgatgttccttatgcacccgtat
gcccagaagcgttcctggggtatctatggagtgtcagtcctcttcatggtcataggtctg
ttctccatgtatttccacatgacactcagcttcgtggggcagctgctggatgagatctcc
atcctgtggttgctggccagtggatacagcgtgtggttgccccgttgctacttccccaag
ttcatcaaggggagcaggttctacttcagctgcctggtaattatgaccaccattatcagc
accttcttgacgttcgtgaagcccacagtcaatgcctatgccctcaacagtatcgccata
cacatcctctacattgtacgcaaagagtacaagaagactagcaacagggatcttcggcat
ctgattgctgtttctgtgatcttgtgggccgccgccctgaccagctgggtcagcgaccgt
gtgctctgcagtttctggcagcggattcagttcttctacctgcatagcatttggcatgtc
ctcataagcatcactttcccttatggtattgtgaccatggccctggtggacgccaagtat
gagatgccagataaaaccctcaaagtccactactggccccgggacagctggctcattggg
ctgccctatgtggagatccaggagaatgacaagaactgctga

KEGG   Rattus norvegicus (rat): 313339
Entry
313339            CDS       T01003                                 

Gene name
Acer2
Definition
(RefSeq) alkaline ceramidase 2
  KO
K01441  alkaline ceramidase [EC:3.5.1.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    313339 (Acer2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    313339 (Acer2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     313339 (Acer2)
SSDB
Motif
Pfam: Ceramidase
Other DBs
NCBI-GeneID: 313339
NCBI-ProteinID: NP_001101413
RGD: 1304629
Ensembl: ENSRNOG00000007637
UniProt: D3ZNW4
Position
5
AA seq 275 aa
MGAPHWWDQLRAGSSEVDWCEDNYTIVPAIAEFYNTISNVLFFILPPICMCLFRQYATCF
NSGIYLIWTLLVVVGIGSVYFHATLSFLGQMLDELAILWVLMCALAMWFPRRYLPKIFRN
DRGRFKAVVCVLSAVTTCLAFVKPAINNISLMILGVPCTALLIAELKRCDNVRVFKLGLF
SGLWWTLALFCWISDRAFCELLSSFHFPYLHCVWHILICLAAYLGCVCFAYFDAASEIPE
QGPVIRFWPSEKWAFIGVPYVSLLCAHKKSPVKIT
NT seq 828 nt   +upstreamnt  +downstreamnt
atgggcgccccgcactggtgggaccagctgcgggctggcagctcggaggtggattggtgc
gaggacaactacaccatcgtgcctgccatcgccgagttctacaacacgatcagcaacgtc
ctgtttttcattttaccgcccatctgcatgtgcttgttccgccagtacgccacgtgcttc
aacagcggcatctatttaatatggactctcctagttgtagtgggaatcggatctgtctac
ttccatgcaactcttagtttcctgggccagatgcttgatgaacttgccattctttgggtt
ctgatgtgtgctttggccatgtggtttcccaggaggtatttaccaaagatctttcggaat
gacaggggcaggttcaaggcagtggtgtgtgtcctgtctgcagttacaacatgcctggcg
tttgtcaagcctgctatcaacaatatctctctgatgattctgggggttccgtgcactgcg
ctgctcattgcagagctgaagaggtgtgacaatgtgcgtgtgtttaagctgggcctcttc
tctggcctttggtggactctggctctcttctgctggatcagtgaccgagccttctgtgag
ctgctgtcctcctttcactttccctacctgcactgcgtgtggcacatcctcatctgcctt
gccgcgtacctgggctgcgtgtgcttcgcctacttcgatgctgcctcagagatacccgaa
caaggtccagtcatcagattctggcccagtgagaaatgggcttttatcggtgtcccctat
gtgtccctcctgtgtgcccacaagaagtcgccagtcaagatcacgtga

KEGG   Rattus norvegicus (rat): 84431
Entry
84431             CDS       T01003                                 

Gene name
Asah1
Definition
(RefSeq) acid ceramidase precursor
  KO
K12348  acid ceramidase [EC:3.5.1.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
rno04142  Lysosome
Module
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    84431 (Asah1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    84431 (Asah1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    84431 (Asah1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    84431 (Asah1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    84431 (Asah1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     84431 (Asah1)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C89
   84431 (Asah1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   84431 (Asah1)
SSDB
Motif
Pfam: CBAH NAAA-beta AAT HP_OMP
Other DBs
NCBI-GeneID: 84431
NCBI-ProteinID: NP_445859
RGD: 621568
Ensembl: ENSRNOG00000010034
UniProt: Q6P7S1
Position
16
AA seq 394 aa
MLGRSLLTWVLAAAVTCAQAQQVPPWTEDCRKSTYPPSGPTYRGPVPWYTINLDLPPYKR
WHELLAHKAPVLRTLVNSISNLVNAFVPSGKIMQMVDEKLPGLIGSIPGPFGEEMRGIAD
VTGIPLGEIISFNIFYELFTMCTSIITEDGKGHLLHGRNMDFGIFLGWNINNNTWVVTEE
LKPLTVNLDFQRNNKTVFKATSFAGYVGMLTGFKPGLLSLTLNERFSLNGGYLGILEWMF
GKKNAQWVGFITRSVLENSTSYEEAKNILTKTKITAPAYFILGGNQSGEGCVITRERKES
LDVYELDPKHGRWYVVQTNYDRWKNTLFLDDRRTPAKKCLNHTTQKNLSFATIYDVLSTK
PVLNKLTVFTTLIDVTKDQFESHLRDCPDPCIGW
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgctgggccgtagtctcctcacctgggtcctggccgcggctgtcacctgcgcccaggca
cagcaagtgccaccgtggacagaagattgcagaaaatcaacttatcctccttctggacca
acctatagaggaccagttccgtggtacaccataaatcttgatttaccaccctacaagaga
tggcatgaattattggctcacaaggcacctgtgttgagaactttagtgaattccatctcg
aatttagtgaatgcatttgtgccaagtggaaaaataatgcagatggtggatgaaaagttg
cctggtctgattggcagcattcctggcccttttggagaggaaatgagggggattgcagat
gttactgggattcctctaggagagattatttcattcaacattttctatgaactgttcacc
atgtgtacatcgatcataactgaagatggaaaaggtcatttactacatggaagaaacatg
gattttggaatatttcttgggtggaacattaacaacaacacttgggtggtgacagaagaa
ttaaagcctttaacagtgaatttggacttccagaggaacaataagactgtgttcaaggct
acaagtttcgctggatacgtgggcatgttgacaggattcaaaccaggactgttaagtctt
acactgaatgaacgtttcagtttaaatggtggttatctgggtatcctagaatggatgttt
ggaaagaaaaatgcccaatgggtagggtttatcactagatcagttctggaaaatagcaca
agttatgaagaagccaagaatatattgaccaagaccaagataacggccccagcatatttt
atcctgggaggcaaccagtctggagaaggttgtgtgattacacgagaaagaaaagagtct
ttagacgtctatgaacttgatcctaagcatggcagatggtacgtggtacaaaccaattat
gaccggtggaaaaacaccttgtttcttgatgaccgcagaacacctgcgaagaagtgtcta
aatcacacgacacagaagaatctgtcatttgctaccatctatgatgttctatcaacaaaa
cctgtcctcaacaagctgactgtattcacaaccttgatagatgtcaccaaagatcaattt
gaaagccaccttcgagattgcccagacccttgtataggctggtga

DBGET integrated database retrieval system