KEGG   Rattus norvegicus (rat): 114105Help
Entry
114105            CDS       T01003                                 

Gene name
Cxcl2, Mip-2, Scyb2
Definition
(RefSeq) C-X-C motif chemokine ligand 2
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05132  Salmonella infection
rno05134  Legionellosis
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    114105 (Cxcl2)
   04668 TNF signaling pathway
    114105 (Cxcl2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114105 (Cxcl2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    114105 (Cxcl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114105 (Cxcl2)
   04657 IL-17 signaling pathway
    114105 (Cxcl2)
   04062 Chemokine signaling pathway
    114105 (Cxcl2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114105 (Cxcl2)
   05134 Legionellosis
    114105 (Cxcl2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    114105 (Cxcl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    114105 (Cxcl2)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   114105 (Cxcl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 114105
NCBI-ProteinID: NP_446099
RGD: 70069
Ensembl: ENSRNOG00000002792
UniProt: P30348
Position
14p22
AA seq 100 aa AA seqDB search
MAPPTRQLLNAVLVLLLLLATNHQGTGVVVASELRCQCLTTLPRVDFKNIQSLTVTPPGP
HCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atggcccctcccactcgccagctcctcaatgctgtactggtcctgctcctcctgctggcc
accaaccatcagggtacaggggttgttgtggccagtgagctgcgctgtcaatgcctgacg
accctaccaagggttgacttcaagaacatccagagcttgacggtgacccctccaggaccc
cactgcgcccagacagaagtcatagccactcttaaggatggtcatgaagtttgtctcaac
cctgaagcccccttggttcagaggatcgtccaaaagatactgaacaaaggcaaggctaac
tga

DBGET integrated database retrieval system