KEGG   Rattus norvegicus (rat): 114105
Entry
114105            CDS       T01003                                 

Gene name
Cxcl2
Definition
(RefSeq) C-X-C motif chemokine 2 precursor
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05134  Legionellosis
rno05146  Amoebiasis
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    114105 (Cxcl2)
   04668 TNF signaling pathway
    114105 (Cxcl2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114105 (Cxcl2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    114105 (Cxcl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114105 (Cxcl2)
   04657 IL-17 signaling pathway
    114105 (Cxcl2)
   04062 Chemokine signaling pathway
    114105 (Cxcl2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    114105 (Cxcl2)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    114105 (Cxcl2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    114105 (Cxcl2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    114105 (Cxcl2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    114105 (Cxcl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    114105 (Cxcl2)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   114105 (Cxcl2)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 114105
NCBI-ProteinID: NP_446099
RGD: 70069
Ensembl: ENSRNOG00000002792
UniProt: P30348
Position
14
AA seq 100 aa
MAPPTRQLLNAVLVLLLLLATNHQGTGVVVASELRCQCLTTLPRVDFKNIQSLTVTPPGP
HCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN
NT seq 303 nt   +upstreamnt  +downstreamnt
atggcccctcccactcgccagctcctcaatgctgtactggtcctgctcctcctgctggcc
accaaccatcagggtacaggggttgttgtggccagtgagctgcgctgtcaatgcctgacg
accctaccaagggttgacttcaagaacatccagagcttgacggtgacccctccaggaccc
cactgcgcccagacagaagtcatagccactcttaaggatggtcatgaagtttgtctcaac
cctgaagcccccttggttcagaggatcgtccaaaagatactgaacaaaggcaaggctaac
tga

KEGG   Rattus norvegicus (rat): 114492
Entry
114492            CDS       T01003                                 

Gene name
Ccl28
Definition
(RefSeq) C-C motif chemokine 28 precursor
  KO
K05513  C-C motif chemokine 28
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114492 (Ccl28)
   04061 Viral protein interaction with cytokine and cytokine receptor
    114492 (Ccl28)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    114492 (Ccl28)
   04062 Chemokine signaling pathway
    114492 (Ccl28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    114492 (Ccl28)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   114492 (Ccl28)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 114492
NCBI-ProteinID: NP_446152
RGD: 619937
Ensembl: ENSRNOG00000059640
UniProt: Q91Y39
Position
2
AA seq 135 aa
MQQAGLTLVAVAVCVAFRTSEAILPIASSCCTEVSHHIPRRLLERVNSCSIQRADGDCDL
AAVILHVKRRRICVSPHNPTLKRWMSASEMKNGKENLCPRKKQDSGKDRKGHTPRKHGKH
GTRRIHGTHGHEAPR
NT seq 408 nt   +upstreamnt  +downstreamnt
atgcagcaagcaggacttaccctcgtggctgtggctgtgtgtgtggcctttcgaacctcg
gaagccatacttcccatagcttccagctgttgcactgaagtttctcatcatattcccaga
agacttctggaaagagtgaattcgtgcagcatccagagagctgatggggactgtgacctg
gctgctgtcatccttcatgttaaacgtagaagaatctgcgtcagcccgcacaatccaact
ttgaagcggtggatgagcgcctcagagatgaagaatggcaaagaaaatctctgccccaga
aagaaacaagacagtgggaaggacagaaaagggcacaccccgagaaagcacggaaaacac
ggaacacgcagaatacatgggacacacggccacgaagcccctcgttag

KEGG   Rattus norvegicus (rat): 116637
Entry
116637            CDS       T01003                                 

Gene name
Ccl4
Definition
(RefSeq) C-C motif chemokine 4 precursor
  KO
K12964  C-C motif chemokine 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04620  Toll-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    116637 (Ccl4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    116637 (Ccl4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    116637 (Ccl4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    116637 (Ccl4)
   04623 Cytosolic DNA-sensing pathway
    116637 (Ccl4)
   04062 Chemokine signaling pathway
    116637 (Ccl4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    116637 (Ccl4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    116637 (Ccl4)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   116637 (Ccl4)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 116637
NCBI-ProteinID: NP_446310
RGD: 620441
Ensembl: ENSRNOG00000011406
Vega: OTTRNOG00000000488
UniProt: P50230
Position
10
AA seq 92 aa
MKLCVSAFSLLLLVAAFCDSVLSAPIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQ
PAVVFLTKKGRQICADPSEPWVNEYVNDLELN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaagctctgcgtgtctgccttctctctcctcctgcttgtggccgccttctgcgattca
gtgctgtcagcaccaataggctctgaccctcccacttcctgctgcttctcttacacctcc
cggaagattcatcggaactttgtgatggattactatgagaccagcagcctttgctcccag
ccagctgtggtatttctgaccaaaaaaggcaggcaaatctgtgccgaccccagcgagccc
tgggtcaatgagtatgtgaatgacttggagttgaactga

KEGG   Rattus norvegicus (rat): 117518
Entry
117518            CDS       T01003                                 

Gene name
Ccl17
Definition
(RefSeq) C-C motif chemokine 17 precursor
  KO
K21083  C-C motif chemokine 17
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    117518 (Ccl17)
   04061 Viral protein interaction with cytokine and cytokine receptor
    117518 (Ccl17)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    117518 (Ccl17)
   04657 IL-17 signaling pathway
    117518 (Ccl17)
   04062 Chemokine signaling pathway
    117518 (Ccl17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    117518 (Ccl17)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   117518 (Ccl17)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 117518
NCBI-ProteinID: NP_476492
RGD: 619924
Ensembl: ENSRNOG00000016278
UniProt: Q9ERE0
Position
19
AA seq 93 aa
MMSLQMLLLAALLLGTSLQHASAARATNVGRECCLDYFKGAIPIRKLVTWFRTSVECPKD
AIVFETVQGRLICTDPKDKHVKKAIRHLKNQRL
NT seq 282 nt   +upstreamnt  +downstreamnt
atgatgtcacttcagatgctgctcctggctgccctgcttctggggacttctctgcagcat
gccagcgctgctcgagccaccaatgtaggccgagagtgctgcctggactacttcaagggg
gccattcccatcaggaagctggtgacgtggttcaggacctcagtggagtgtcccaaggat
gccatcgtgtttgagactgtccagggaaggcttatctgcacagaccccaaagacaagcat
gtgaagaaggccatcagacacctgaaaaaccaaaggctgtga

KEGG   Rattus norvegicus (rat): 117551
Entry
117551            CDS       T01003                                 

Gene name
Ccl22
Definition
(RefSeq) C-C motif chemokine 22 precursor
  KO
K21095  C-C motif chemokine 22
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    117551 (Ccl22)
   04061 Viral protein interaction with cytokine and cytokine receptor
    117551 (Ccl22)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    117551 (Ccl22)
   04062 Chemokine signaling pathway
    117551 (Ccl22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    117551 (Ccl22)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   117551 (Ccl22)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 117551
NCBI-ProteinID: NP_476551
RGD: 619933
Ensembl: ENSRNOG00000016535
UniProt: Q5I0L5
Position
19
AA seq 92 aa
MASLRVPLLVALVLLAVALQTSDAGPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSC
RKPGVVLITIKNRDICADPRMLWVKKILHKLA
NT seq 279 nt   +upstreamnt  +downstreamnt
atggccagcctgcgagtcccactcctggtggctctcgtccttcttgctgtggcacttcag
acctccgatgcaggtccctatggtgccaatgtggaagacagtatctgctgccaggactac
atccgtcaccctctgccaccacgtttcgtgaaggagttctactggacctcaaagtcctgc
cgcaagcctggcgtcgttttgataaccatcaagaaccgagatatctgtgctgaccccagg
atgctctgggtgaagaagatactccacaagttggcctag

KEGG   Rattus norvegicus (rat): 171371
Entry
171371            CDS       T01003                                 

Gene name
Xcl1
Definition
(RefSeq) lymphotactin precursor
  KO
K05507  C motif chemokine 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    171371 (Xcl1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    171371 (Xcl1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    171371 (Xcl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    171371 (Xcl1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   171371 (Xcl1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 171371
NCBI-ProteinID: NP_599188
RGD: 620452
Ensembl: ENSRNOG00000002964
UniProt: P51672
Position
13
AA seq 114 aa
MRLLLLTFLGVCCFAAWVVEGVGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIF
VTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG
NT seq 345 nt   +upstreamnt  +downstreamnt
atgagacttctcctcctgactttcctgggagtctgctgcttcgccgcatgggttgtggaa
ggtgtgggcactgaagtcctacaagagagtatctgtgtgagcttaagaacccagcggctg
ccagttcaaaaaatcaagacctacaccatcaaggagggagccatgagagctgtaattttt
gtcaccaaacgaggactaagaatttgtgctgatccacaagccaaatgggtgaaaacagcc
atcaaaaccgtagatggcagggccagtgccagcaagagcaaggctgaaactattcccaca
caagcccagaggtccgccagcacagcagtaaccctgactgggtaa

KEGG   Rattus norvegicus (rat): 171551
Entry
171551            CDS       T01003                                 

Gene name
Cxcl3
Definition
(RefSeq) C-X-C motif chemokine 3 precursor
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05134  Legionellosis
rno05146  Amoebiasis
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    171551 (Cxcl3)
   04668 TNF signaling pathway
    171551 (Cxcl3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    171551 (Cxcl3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    171551 (Cxcl3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    171551 (Cxcl3)
   04657 IL-17 signaling pathway
    171551 (Cxcl3)
   04062 Chemokine signaling pathway
    171551 (Cxcl3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    171551 (Cxcl3)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    171551 (Cxcl3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    171551 (Cxcl3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    171551 (Cxcl3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    171551 (Cxcl3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    171551 (Cxcl3)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   171551 (Cxcl3)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 171551
NCBI-ProteinID: NP_612531
RGD: 621812
Ensembl: ENSRNOG00000028043
UniProt: Q10746
Position
14
AA seq 100 aa
MAPPTRRLLNAALLLLLLLMATSHQPSGTVVARELRCQCLKTLPRVDFENIQSLTVTPPG
PHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSPSL
NT seq 303 nt   +upstreamnt  +downstreamnt
atggcccctcccacccgccggctcctcaatgctgcactgcttctgctgcttctgctgatg
gccaccagccaccagccttcagggactgttgtggcccgtgagctgcgctgtcagtgcctg
aagaccctaccaagggttgattttgagaacatccagagcttgacggtgacccctccagga
ccgcactgcacccagacagaagtcatagccactctcaaggatggtcaagaagtttgtctc
aaccctcaagctcccaggcttcagaaaatcatccagaagttactgaagagcccctccctg
tga

KEGG   Rattus norvegicus (rat): 245920
Entry
245920            CDS       T01003                                 

Gene name
Cxcl10
Definition
(RefSeq) C-X-C motif chemokine 10 precursor
  KO
K12671  C-X-C motif chemokine 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04620  Toll-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05160  Hepatitis C
rno05164  Influenza A
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    245920 (Cxcl10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    245920 (Cxcl10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    245920 (Cxcl10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    245920 (Cxcl10)
   04622 RIG-I-like receptor signaling pathway
    245920 (Cxcl10)
   04623 Cytosolic DNA-sensing pathway
    245920 (Cxcl10)
   04657 IL-17 signaling pathway
    245920 (Cxcl10)
   04062 Chemokine signaling pathway
    245920 (Cxcl10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    245920 (Cxcl10)
   05171 Coronavirus disease - COVID-19
    245920 (Cxcl10)
   05164 Influenza A
    245920 (Cxcl10)
   05169 Epstein-Barr virus infection
    245920 (Cxcl10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    245920 (Cxcl10)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    245920 (Cxcl10)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   245920 (Cxcl10)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Chemokines
   245920 (Cxcl10)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 245920
NCBI-ProteinID: NP_620789
RGD: 620209
Ensembl: ENSRNOG00000022256
UniProt: P48973
Position
14
AA seq 98 aa
MNPSAAVVLCLVLLSLSGTQGIPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHV
EIIATMKKNNEKRCLNPESEAIKSLLKAVSQRRSKRAP
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaacccaagtgctgctgtcgttctctgcctcgtgctgctgagtctgagtgggactcaa
gggatccctctcgcaagaacggtgcgctgcacctgcatcgacttccatgaacagccgctg
agacccagggccataggaaaacttgaaatcattcctgcaagtctatcctgtccgcatgtt
gagatcattgccacaatgaaaaagaacaatgagaagaggtgtctgaatccggaatctgag
gccatcaagagcttattgaaagcggtgagccaaagaaggtctaaaagagctccgtaa

KEGG   Rattus norvegicus (rat): 246358
Entry
246358            CDS       T01003                                 

Gene name
Ppbp
Definition
(RefSeq) platelet basic protein precursor
  KO
K10029  platelet basic protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    246358 (Ppbp)
   04061 Viral protein interaction with cytokine and cytokine receptor
    246358 (Ppbp)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    246358 (Ppbp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    246358 (Ppbp)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   246358 (Ppbp)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 246358
NCBI-ProteinID: NP_714943
RGD: 70548
Ensembl: ENSRNOG00000002829
UniProt: Q99ME0
Position
14
AA seq 111 aa
MGFRLRPTSSCTRASSLRNLQVLLSLLLVALVPLAVGKPDNNEPFIELRCRCTNTLSGIP
LNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKILEGY
NT seq 336 nt   +upstreamnt  +downstreamnt
atgggcttcagactcagacctacatcctcctgcaccagggccagctctcttcgtaaccta
caggtgctgctgagcctgcttctcgttgcgctggttccccttgcagttggaaaacctgat
aacaacgagccatttatcgaattgcgctgcagatgtacgaatacactctctggaatccca
ctgaactctatctcccgtgtgaatgtgttccggccaggagcgcactgtgacaatgtggaa
gtgatagccacactgaagaatggaaaggaagtgtgcctggacccgactgcccctatgatc
aagaaaatcgtcaagaagatattggaaggttattga

KEGG   Rattus norvegicus (rat): 246759
Entry
246759            CDS       T01003                                 

Gene name
Cxcl9
Definition
(RefSeq) C-X-C motif chemokine 9 precursor
  KO
K05416  C-X-C motif chemokine 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    246759 (Cxcl9)
   04061 Viral protein interaction with cytokine and cytokine receptor
    246759 (Cxcl9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    246759 (Cxcl9)
   04062 Chemokine signaling pathway
    246759 (Cxcl9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    246759 (Cxcl9)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   246759 (Cxcl9)
SSDB
Motif
Pfam: IL8 Rtf2 Ku_C
Other DBs
NCBI-GeneID: 246759
NCBI-ProteinID: NP_663705
RGD: 628798
Ensembl: ENSRNOG00000022242
UniProt: Q8K4B1
Position
14
AA seq 125 aa
MKSVALFLMGIIFLDHCGVRGTLVIRNQRCSCISTSQGTFHYKSLKDLKQFAPSPNCNKT
EIIATLKNGDQTCLDPDSARVKKLMKEWEKKISQKKKQKRGKNHQRSKKTRKAKTPHHPE
SKKTA
NT seq 378 nt   +upstreamnt  +downstreamnt
atgaagtccgttgctctattcctcatgggcatcatcttcctggatcactgtggagttcga
ggaaccctagtgataaggaatcagcgatgctcctgcatcagcaccagccaaggcacattc
cactacaaatccctcaaagacctcaaacagtttgccccaagccctaactgcaacaaaact
gaaatcatcgctacactgaagaacggagatcaaacctgcctagacccagattcagcaagg
gtgaagaagctgatgaaagaatgggagaaaaagatcagccaaaagaaaaagcaaaagagg
gggaaaaaccatcaaaggagcaagaaaacccgaaaagctaaaacaccccaccatccggag
tcaaagaagactgcataa

KEGG   Rattus norvegicus (rat): 24770
Entry
24770             CDS       T01003                                 

Gene name
Ccl2
Definition
(RefSeq) C-C motif chemokine 2 precursor
  KO
K14624  C-C motif chemokine 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05135  Yersinia infection
rno05142  Chagas disease
rno05144  Malaria
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    24770 (Ccl2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24770 (Ccl2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    24770 (Ccl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    24770 (Ccl2)
   04657 IL-17 signaling pathway
    24770 (Ccl2)
   04062 Chemokine signaling pathway
    24770 (Ccl2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    24770 (Ccl2)
   05164 Influenza A
    24770 (Ccl2)
   05168 Herpes simplex virus 1 infection
    24770 (Ccl2)
   05163 Human cytomegalovirus infection
    24770 (Ccl2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    24770 (Ccl2)
  09174 Infectious disease: parasitic
   05144 Malaria
    24770 (Ccl2)
   05142 Chagas disease
    24770 (Ccl2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    24770 (Ccl2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24770 (Ccl2)
   05418 Fluid shear stress and atherosclerosis
    24770 (Ccl2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    24770 (Ccl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24770 (Ccl2)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24770 (Ccl2)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   24770 (Ccl2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Chemokines
   24770 (Ccl2)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 24770
NCBI-ProteinID: NP_113718
RGD: 3645
Ensembl: ENSRNOG00000007159
UniProt: P14844
Position
10
AA seq 148 aa
MQVSVTLLGLLFTVAACSIHVLSQPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCP
KEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLT
HKSEANASTLFSTTTSSTSVEVTSMTEN
NT seq 447 nt   +upstreamnt  +downstreamnt
atgcaggtctctgtcacgcttctgggcctgttgttcacagttgctgcctgtagcatccac
gtgctgtctcagccagatgcagttaatgccccactcacctgctgctactcattcactggc
aagatgatcccaatgagtcggctggagaactacaagagaatcaccagcagcaggtgtccc
aaagaagctgtagtatttgtcaccaagctcaagagagagatctgtgctgaccccaataag
gaatgggtccagaagtacattagaaaactggaccagaaccaagtgagatcagaaactaca
gtcttctataaaattgcatcaaccctaaggacttcagcacctttgaatgtgaacttgacc
cataaatctgaagctaatgcatccactctcttttccacaaccacctcaagcacttctgta
gaagtgaccagtatgacagagaactag

KEGG   Rattus norvegicus (rat): 24772
Entry
24772             CDS       T01003                                 

Gene name
Cxcl12
Definition
(RefSeq) stromal cell-derived factor 1 isoform beta precursor
  KO
K10031  C-X-C motif chemokine 12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04360  Axon guidance
rno04670  Leukocyte transendothelial migration
rno04672  Intestinal immune network for IgA production
rno04810  Regulation of actin cytoskeleton
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    24772 (Cxcl12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24772 (Cxcl12)
   04061 Viral protein interaction with cytokine and cytokine receptor
    24772 (Cxcl12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24772 (Cxcl12)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    24772 (Cxcl12)
   04672 Intestinal immune network for IgA production
    24772 (Cxcl12)
   04062 Chemokine signaling pathway
    24772 (Cxcl12)
  09158 Development and regeneration
   04360 Axon guidance
    24772 (Cxcl12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24772 (Cxcl12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    24772 (Cxcl12)
  09163 Immune disease
   05323 Rheumatoid arthritis
    24772 (Cxcl12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24772 (Cxcl12)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24772 (Cxcl12)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   24772 (Cxcl12)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Chemokines
   24772 (Cxcl12)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 24772
NCBI-ProteinID: NP_001029054
RGD: 3651
Ensembl: ENSRNOG00000013589
Position
4
AA seq 93 aa
MDAKVVAVLALVLAALCISDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKSNNRQVCIDPKLKWIQEYLDKALNKRLKM
NT seq 282 nt   +upstreamnt  +downstreamnt
atggacgccaaggtcgtcgccgtgctggccctggtgctggccgcgctctgcatcagtgac
ggtaagccagtcagcctgagctacagatgcccctgccgattctttgagagccatgtcgcc
agagccaacgtcaaacatctgaaaatcctcaacactccaaactgtgcccttcagattgtt
gcaaggctgaaaagcaacaacagacaagtgtgcattgacccgaaattaaagtggatccaa
gagtacctggacaaagccttaaacaagaggctcaagatgtga

KEGG   Rattus norvegicus (rat): 25542
Entry
25542             CDS       T01003                                 

Gene name
Ccl3
Definition
(RefSeq) C-C motif chemokine 3 precursor
  KO
K05408  C-C motif chemokine 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04620  Toll-like receptor signaling pathway
rno05142  Chagas disease
rno05163  Human cytomegalovirus infection
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25542 (Ccl3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    25542 (Ccl3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    25542 (Ccl3)
   04062 Chemokine signaling pathway
    25542 (Ccl3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    25542 (Ccl3)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    25542 (Ccl3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    25542 (Ccl3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25542 (Ccl3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    25542 (Ccl3)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25542 (Ccl3)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   25542 (Ccl3)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Chemokines
   25542 (Ccl3)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 25542
NCBI-ProteinID: NP_037157
RGD: 3647
Ensembl: ENSRNOG00000011205
Vega: OTTRNOG00000000486
UniProt: P50229
Position
10
AA seq 92 aa
MKVSTAALAVLLCTMALWNEVFSAPYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQP
GVIFLTKRNRQICADPKETWVQEYITELELNA
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaaggtctccaccgctgcccttgctgttcttctctgcaccatggcgctctggaacgaa
gtcttctcagcgccatatggagctgacaccccgactgcctgctgcttctcctatggacgg
caaattccacgaaaattcattgctgactattttgagaccagcagcctttgctcccagccg
ggtgtcattttcctgaccaagagaaaccggcagatctgcgctgaccccaaagagacctgg
gtccaagaatacatcactgagctggaactaaatgcctga

KEGG   Rattus norvegicus (rat): 287561
Entry
287561            CDS       T01003                                 

Gene name
Ccl7
Definition
(RefSeq) C-C motif chemokine 7 precursor
  KO
K05509  C-C motif chemokine 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    287561 (Ccl7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    287561 (Ccl7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    287561 (Ccl7)
   04062 Chemokine signaling pathway
    287561 (Ccl7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    287561 (Ccl7)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   287561 (Ccl7)
SSDB
Motif
Pfam: IL8 Laminin_G_3
Other DBs
NCBI-GeneID: 287561
NCBI-ProteinID: NP_001007613
RGD: 1359152
Ensembl: ENSRNOG00000000239
UniProt: Q9QXY8
Position
10
AA seq 97 aa
MQISAALLCVLLTAAAFTVHVWAQPDGTNSSTCCYVKKQKIPKRNLKSYRKITSSRCPWE
AVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTSTPKP
NT seq 294 nt   +upstreamnt  +downstreamnt
atgcagatctctgccgcgcttctgtgtgtgctgctcacagctgctgctttcaccgtgcac
gtgtgggcccaaccagatgggaccaattcatccacttgctgctatgtcaagaaacaaaag
attcccaagaggaatctcaagagttacagaaagatcaccagtagtcggtgtccctgggaa
gctgttatcttcaagaccaaaaagggcatggaagtctgtgctgaagcccatcagaagtgg
gttgaggaggccatagcatacttagacatgaaaacttcaactccaaagccctga

KEGG   Rattus norvegicus (rat): 287562
Entry
287562            CDS       T01003                                 

Gene name
Ccl12
Definition
(RefSeq) chemokine (C-C motif) ligand 12 precursor
  KO
K14624  C-C motif chemokine 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05135  Yersinia infection
rno05142  Chagas disease
rno05144  Malaria
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    287562 (Ccl12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    287562 (Ccl12)
   04061 Viral protein interaction with cytokine and cytokine receptor
    287562 (Ccl12)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    287562 (Ccl12)
   04657 IL-17 signaling pathway
    287562 (Ccl12)
   04062 Chemokine signaling pathway
    287562 (Ccl12)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    287562 (Ccl12)
   05164 Influenza A
    287562 (Ccl12)
   05168 Herpes simplex virus 1 infection
    287562 (Ccl12)
   05163 Human cytomegalovirus infection
    287562 (Ccl12)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    287562 (Ccl12)
  09174 Infectious disease: parasitic
   05144 Malaria
    287562 (Ccl12)
   05142 Chagas disease
    287562 (Ccl12)
  09163 Immune disease
   05323 Rheumatoid arthritis
    287562 (Ccl12)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    287562 (Ccl12)
   05418 Fluid shear stress and atherosclerosis
    287562 (Ccl12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    287562 (Ccl12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    287562 (Ccl12)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    287562 (Ccl12)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   287562 (Ccl12)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Chemokines
   287562 (Ccl12)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 287562
NCBI-ProteinID: NP_001099292
RGD: 1309255
Ensembl: ENSRNOG00000029768
UniProt: D4ABS1
Position
10
AA seq 98 aa
MKISTLLCLLLIAAAISPQVLAGPDSVFTPVTCCYNVAKQKIHIRRLKSYRKITSSQCPR
EAVIFRTVLDKELCADPKEKWVKDSMNHLDQKSRTQHP
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaagatctccacccttctttgccttctgctcatagctgccgccatcagcccacaggtg
ttggctggaccagattcagtgttcaccccagtcacctgctgttataatgtcgctaagcag
aagatccacattcggaggctaaagagctacaggaaaatcacaagcagccagtgtccccgg
gaagctgtgatcttcagaactgtactggataaggagctctgtgctgaccccaaggagaag
tgggttaaggactccatgaaccacttggatcagaagtctcgaactcagcatccttga

KEGG   Rattus norvegicus (rat): 287910
Entry
287910            CDS       T01003                                 

Gene name
Ccl6
Definition
(RefSeq) C-C motif chemokine 6 precursor
  KO
K05510  C-C motif chemokine 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    287910 (Ccl6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    287910 (Ccl6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    287910 (Ccl6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    287910 (Ccl6)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   287910 (Ccl6)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 287910
NCBI-ProteinID: NP_001004202
RGD: 1303200
Ensembl: ENSRNOG00000030021
Vega: OTTRNOG00000000485
UniProt: Q68FP3
Position
10
AA seq 115 aa
MRHSKTAISFFILVAVLGSQAGLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCS
RFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA
NT seq 348 nt   +upstreamnt  +downstreamnt
atgagacattccaagactgccatttcattctttatccttgtggccgtccttgggtcccag
gctgggctcatacaagatacggtaaaagaagatcgtccctttaatcctacaataattcac
caaggctttcaagactcttcagactgctgcttctcctatgcctcacagatcccatgttca
agatttatatattattttccaaccagtggtgggtgcaccaagccaggcatcatctttgtc
accaggaagaggaagcgggtctgtgccaacccgagtgatcagagagttcagacgtgcata
agcaccctgaagctaggcccaagatctgggaacagtgccattgcttga

KEGG   Rattus norvegicus (rat): 288593
Entry
288593            CDS       T01003                                 

Gene name
Ccl24
Definition
(RefSeq) C-C motif chemokine 24 precursor
  KO
K21097  C-C motif chemokine 24
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    288593 (Ccl24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    288593 (Ccl24)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    288593 (Ccl24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    288593 (Ccl24)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   288593 (Ccl24)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 288593
NCBI-ProteinID: NP_001013063
RGD: 1310245
Ensembl: ENSRNOG00000031162
UniProt: Q5PPP2
Position
12
AA seq 119 aa
MAGSTTIIASLLLLVACTCCICPTGSVTIPSSCCVTFISKKIPVNRVISYQLANGSICPK
AGVIFITKKGHKICTDPKLPWVQKHIKNLDAKRNQPSEGAKALGPKFVIQKLRGNSTKV
NT seq 360 nt   +upstreamnt  +downstreamnt
atggcaggctccaccaccatcattgctagccttctactcctggtagcctgcacgtgctgc
atctgccccacaggctctgtgaccatcccctcatcttgctgcgtgacctttatttccaag
aagattccagtaaaccgagtgattagctaccagttggccaatggcagcatctgtcccaag
gcaggggtcatcttcatcactaaaaagggccataagatctgtacggatcccaagttgcca
tgggttcagaagcacataaagaacctggatgccaagagaaaccagccttctgaaggtgcc
aaggccctgggtcccaagtttgtcatccagaaactccgaggcaatagcaccaaggtttag

KEGG   Rattus norvegicus (rat): 29397
Entry
29397             CDS       T01003                                 

Gene name
Ccl11
Definition
(RefSeq) eotaxin precursor
  KO
K16597  C-C motif chemokine 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04657  IL-17 signaling pathway
rno05310  Asthma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29397 (Ccl11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    29397 (Ccl11)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    29397 (Ccl11)
   04062 Chemokine signaling pathway
    29397 (Ccl11)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    29397 (Ccl11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    29397 (Ccl11)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   29397 (Ccl11)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 29397
NCBI-ProteinID: NP_062078
RGD: 3644
Ensembl: ENSRNOG00000007335
UniProt: P97545
Position
10
AA seq 97 aa
MQLSTALLFLLLTATSFTSQVLAHPGSIPTSCCFTMTSKKIPNTLLKSYKRITNNRCTLK
AIVFKTKLGKEICADPKKKWVQDATKHLDQKLQTPKP
NT seq 294 nt   +upstreamnt  +downstreamnt
atgcagctctccacagcacttctattcctgctgctcacggccacttccttcacctcccag
gtgctggctcacccaggttccatcccaacttcctgctgctttaccatgaccagtaagaag
atccccaacacactactgaagagctacaaaagaatcaccaacaacagatgcacgctgaaa
gccatagtcttcaagaccaagcttggcaaagagatctgtgctgaccccaagaaaaagtgg
gtccaggatgccacaaagcacctggaccaaaaactccaaactccaaaaccataa

KEGG   Rattus norvegicus (rat): 29538
Entry
29538             CDS       T01003                                 

Gene name
Ccl20
Definition
(RefSeq) C-C motif chemokine 20 precursor
  KO
K14625  C-C motif chemokine 20
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    29538 (Ccl20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29538 (Ccl20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    29538 (Ccl20)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    29538 (Ccl20)
   04062 Chemokine signaling pathway
    29538 (Ccl20)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    29538 (Ccl20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    29538 (Ccl20)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   29538 (Ccl20)
SSDB
Motif
Pfam: IL8 NAD_synthase
Other DBs
NCBI-GeneID: 29538
NCBI-ProteinID: NP_062106
RGD: 3646
Ensembl: ENSRNOG00000015992
UniProt: P97884
Position
9
AA seq 96 aa
MACKHLPFLALAGVLLAYLCSQSEAASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDI
NAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM
NT seq 291 nt   +upstreamnt  +downstreamnt
atggcctgcaagcatctgcccttcctggctttggcgggggtactgctggcttacctctgc
agccagtcagaagcagcaagcaactttgactgctgcctcacgtacacaaagaacgtgtat
catcatgcgagaaattttgtgggtttcacaacacagatggccgacgaagcttgtgacatt
aatgctatcatctttcacctgaagtcgaaaagatccgtgtgcgctgacccaaagcagatc
tgggtgaaaaggattttgcacctcctcagcctaagaaccaagaagatgtaa

KEGG   Rattus norvegicus (rat): 298006
Entry
298006            CDS       T01003                                 

Gene name
Ccl21
Definition
(RefSeq) C-C motif chemokine 21 precursor
  KO
K16062  C-C motif chemokine 21
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    298006 (Ccl21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    298006 (Ccl21)
   04061 Viral protein interaction with cytokine and cytokine receptor
    298006 (Ccl21)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    298006 (Ccl21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    298006 (Ccl21)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   298006 (Ccl21)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 298006
NCBI-ProteinID: NP_001008513
RGD: 1311996
Ensembl: ENSRNOG00000034290
UniProt: Q5RJN3
Position
5
AA seq 133 aa
MAQMLALSLLSLVLVLCVPWTQGSDGGGQDCCLRYSQKKIPYNIVRGYRKQEPSLGCPIP
AILFAPRKQSQPELCANPEEAWVQKLMRRLDQPPAPGKQNCRKNRGTSKSGKKGRGSKGC
KGTEQTDSKRVSQ
NT seq 402 nt   +upstreamnt  +downstreamnt
atggctcagatgctggctctgagcctccttagcttggtcctggttctctgcgtcccgtgg
acccaaggcagtgacggagggggtcaggactgctgtcttaggtacagccagaagaagatt
ccctacaacattgtccgaggctacaggaagcaagaaccgagcctaggttgccccatccca
gcaatcctgttcgcaccccggaagcaatctcagcctgagctatgcgcaaaccctgaggaa
gcctgggtgcagaagctgatgcgacgtctggaccagcctccagccccagggaaacaaaac
tgcaggaagaatcgaggaacctctaagtctgggaagaaaggaaggggctccaaaggctgc
aaggggactgaacagacagactccaagagggtatcccagtga

KEGG   Rattus norvegicus (rat): 305236
Entry
305236            CDS       T01003                                 

Gene name
Cxcl11
Definition
(RefSeq) C-X-C motif chemokine 11 precursor
  KO
K12672  C-X-C motif chemokine 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    305236 (Cxcl11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    305236 (Cxcl11)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    305236 (Cxcl11)
   04062 Chemokine signaling pathway
    305236 (Cxcl11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    305236 (Cxcl11)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   305236 (Cxcl11)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 305236
NCBI-ProteinID: NP_891997
RGD: 727827
Ensembl: ENSRNOG00000022298
UniProt: Q7TNL0
Position
14
AA seq 100 aa
MNRTGMAVALAMIIWATTVPGFVMFKGGRCLCIDRGVKVVKMAAIKEVSVIYPSNGCDKV
EVIVTLKAHKGQRCLDPTSKQARLIMQTIQKKNFLRRQNM
NT seq 303 nt   +upstreamnt  +downstreamnt
atgaacaggacgggcatggccgtagccctggctatgatcatctgggccacaacggttcca
ggcttcgttatgttcaaaggggggcgctgtctttgcatcgaccgcggagtgaaagtggtc
aaaatggcagcaatcaaggaagtttctgtaatttacccgagtaacggctgtgacaaagtt
gaagtgattgttaccctgaaggctcataaaggacaaaggtgcctggaccccacatccaag
caagctcgcctcataatgcagacaatacaaaaaaagaattttttaaggcgccagaacatg
tga

KEGG   Rattus norvegicus (rat): 306748
Entry
306748            CDS       T01003                                 

Gene name
Cxcl14
Definition
(RefSeq) C-X-C motif chemokine 14 precursor
  KO
K10033  C-X-C motif chemokine 14
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    306748 (Cxcl14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    306748 (Cxcl14)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    306748 (Cxcl14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    306748 (Cxcl14)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   306748 (Cxcl14)
SSDB
Motif
Pfam: IL8 DUF6355 NinB
Other DBs
NCBI-GeneID: 306748
NCBI-ProteinID: NP_001013155
RGD: 1307406
Ensembl: ENSRNOG00000011984
UniProt: Q8K453
Position
17
AA seq 99 aa
MRLLAAALLLLLLALCASRVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITT
KSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaggctcctggcggccgcgctgctcctgctgctcctggcgctgtgcgcctcgcgcgtg
gacgggtccaagtgtaagtgttcccggaaggggcccaagatccgctacagcgacgtgaag
aagctggaaatgaagccaaagtacccacactgcgaggagaagatggttatcataaccacc
aagagcatgtccaggtaccgcggccaggagcactgcctgcatcctaagctgcaaagtacc
aagcgcttcatcaaatggtacaacgcctggaacgagaaacgcagggtctacgaagagtag

KEGG   Rattus norvegicus (rat): 360579
Entry
360579            CDS       T01003                                 

Gene name
Ccl9
Definition
(RefSeq) C-C motif chemokine 9 precursor
  KO
K22671  C-C motif chemokine 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    360579 (Ccl9)
   04061 Viral protein interaction with cytokine and cytokine receptor
    360579 (Ccl9)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    360579 (Ccl9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    360579 (Ccl9)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   360579 (Ccl9)
SSDB
Motif
Pfam: IL8 WYL_3
Other DBs
NCBI-GeneID: 360579
NCBI-ProteinID: NP_001012357
RGD: 1310563
Ensembl: ENSRNOG00000028548
Vega: OTTRNOG00000000483
UniProt: Q5FVN3
Position
10
AA seq 117 aa
MKPFHTALSFLIFAATLGIQAQIVHATETREVLKAEQGHQLFSLGFQDSSDCCLSYTSRV
HCSRYKNYFPTSGGCTKPAIIFVSKKGTLVCANPSDLRVQKCIKRLEQNSQPQIYKQ
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagccctttcatactgccctctccttcctcatttttgcagctactcttggaatccag
gcccagatcgtacatgcgacagagacaagagaagtcctgaaggcagagcaaggacatcag
ctttttagcctgggctttcaagactcttcagactgctgcttatcctatacctcacgggtc
cattgttcaagatataaaaattattttccaaccagtggtgggtgcaccaagccggccatc
atctttgtcagcaagaaggggaccttggtctgtgccaaccccagtgatctgagagttcag
aagtgcattaaaagattggagcaaaactcacaaccacagatctacaaacaataa

KEGG   Rattus norvegicus (rat): 360750
Entry
360750            CDS       T01003                                 

Gene name
Ccl25
Definition
(RefSeq) C-C motif chemokine 25 precursor
  KO
K13072  C-C motif chemokine 25
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    360750 (Ccl25)
   04061 Viral protein interaction with cytokine and cytokine receptor
    360750 (Ccl25)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    360750 (Ccl25)
   04062 Chemokine signaling pathway
    360750 (Ccl25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    360750 (Ccl25)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   360750 (Ccl25)
SSDB
Motif
Pfam: IL8 PIP49_N RecA
Other DBs
NCBI-GeneID: 360750
NCBI-ProteinID: NP_001032280
RGD: 1305530
Ensembl: ENSRNOG00000028531
UniProt: Q32PX4
Position
12
AA seq 147 aa
MKLQLFACLAACFVGAWVPVVRAQGAFEDCCLGYQPRIKWNVLRHARHYHQQEVSGSCNL
RAVIFYFRQKVVVCGNPEDKDVKRAVKILTARKQPVHSPQKSTSDYPTERKKSNYMKFKV
ENPKGTRMRNATLGHPRMVMMSRKTNN
NT seq 444 nt   +upstreamnt  +downstreamnt
atgaaactgcagctgttcgcctgcctggctgcctgctttgttggggcctgggtgccagtt
gtccgtgcccaaggtgcctttgaagactgctgcctgggttaccagcctaggatcaaatgg
aatgttctccggcatgctaggcattatcaccagcaggaagtgagtggaagctgcaacctc
cgtgctgtgatattctacttccgccagaaagtagtagtgtgtgggaatccagaggacaag
gatgtgaagagggctgtgaagatcttaacagctaggaagcagccagtccacagtccccag
aagagcacctcagactatccgaccgaaaggaagaagtcaaactacatgaagttcaaggtg
gagaaccccaagggcacaaggatgaggaatgccaccctgggtcatcccaggatggtgatg
atgtccagaaagaccaacaattaa

KEGG   Rattus norvegicus (rat): 360918
Entry
360918            CDS       T01003                                 

Gene name
Pf4
Definition
(RefSeq) platelet factor 4 precursor
  KO
K05407  platelet factor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    360918 (Pf4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    360918 (Pf4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    360918 (Pf4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    360918 (Pf4)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    360918 (Pf4)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   360918 (Pf4)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Chemokines
   360918 (Pf4)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 360918
NCBI-ProteinID: NP_001007730
RGD: 3305
Ensembl: ENSRNOG00000028015
UniProt: P06765
Position
14
AA seq 105 aa
MSAAAVFRGLRPSPELLLLGLLLLPAVVAVTRASPEESDGDLSCVCVKTSSSRIHLKRIT
SLEVIKAGPHCAVPQLIATLKNGSKICLDRQVPLYKKIIKKLLES
NT seq 318 nt   +upstreamnt  +downstreamnt
atgagtgccgctgcggtgtttcgaggcctccggcccagccctgagctgcttcttctgggt
ctgctgttgctgccagctgtggttgctgtcaccagggctagtcctgaagaaagcgacgga
gatcttagctgtgtgtgtgtgaagaccagttcttccaggatccatctcaaacgcatcacc
agcctggaggtgatcaaagcaggaccccactgtgcggttccccagctcatagccacgctg
aagaatgggagcaaaatttgcctggaccggcaagtacctctgtataagaaaataatcaag
aaactcctggagagttag

KEGG   Rattus norvegicus (rat): 362505
Entry
362505            CDS       T01003                                 

Gene name
Ccl27
Definition
(RefSeq) C-C motif chemokine 27
  KO
K16598  C-C motif chemokine 27
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    362505 (Ccl27)
   04061 Viral protein interaction with cytokine and cytokine receptor
    362505 (Ccl27)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    362505 (Ccl27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    362505 (Ccl27)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   362505 (Ccl27)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 362505
NCBI-ProteinID: NP_001102130
RGD: 1304660
Ensembl: ENSRNOG00000039530
UniProt: D4AAL6
Position
5
AA seq 164 aa
MSRLRRYEVALEAEEEIYWGCFYFFPWLRMWRRERSPMPPTSQRLSLEPPRLPLTGWHPW
NKTKEKQEALPLPSSTSCCTQLYRQPLPTRLLRRIVRVELQEADGDCHLQAVVLHLTRRS
VCVHPQNRSLARWLERHGKRLQGTLPSLNPVLQKKMCPSPQKQK
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcgcgattgaggagatacgaggtggcgctggaagcggaggaggagatctactggggc
tgcttctacttttttccttggctgcgaatgtggcgcagggagcggagtccgatgcctcca
acaagccagagactaagtctggaaccccccaggctcccgctgacaggctggcatccgtgg
aacaagactaaggagaagcaagaagccttgccactgccctccagcactagctgctgtact
cagctctataggcaaccactcccaaccagactactgaggaggatcgtccgtgtggagctg
caggaggctgacggggactgccacctccaagctgttgtgcttcacctgactcggcgcagt
gtctgtgttcatccccagaaccgtagcctggctcggtggttagaacgccatgggaaaagg
ctccaggggaccctacccagtttaaatccggtactacaaaagaaaatgtgcccgagcccc
caaaagcaaaagtaa

KEGG   Rattus norvegicus (rat): 362506
Entry
362506            CDS       T01003                                 

Gene name
Ccl19
Definition
(RefSeq) C-C motif chemokine 19 precursor
  KO
K05512  C-C motif chemokine 19
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    362506 (Ccl19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    362506 (Ccl19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    362506 (Ccl19)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    362506 (Ccl19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    362506 (Ccl19)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   362506 (Ccl19)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 362506
NCBI-ProteinID: NP_001102131
RGD: 1310336
Ensembl: ENSRNOG00000015668
UniProt: D3ZI84
Position
5
AA seq 108 aa
MASRVTPLLAFSLLVLWTFSAPALGGANDAEDCCLSVTQRPIPGNIVKAFRYLLIQDGCR
VPAVVFTTLRGYQLCAPLDQPWVERIIRRLKKSSSKSKGGSTKRGPVS
NT seq 327 nt   +upstreamnt  +downstreamnt
atggcatcccgtgtgaccccactactggccttcagcctgctggttctctggaccttctca
gccccagctctggggggtgctaacgatgcggaagactgctgcctgtctgtgacccagcgc
cccatccctggtaacatcgtgaaagccttccgctaccttcttatccaagatggctgcagg
gtgcctgctgttgtgttcaccacactaaggggctaccagctctgtgcacctctagaccag
ccctgggtagaacgcatcatccgaagactgaagaagtcttcctccaagagcaaaggcggc
agcaccaaaaggggccctgtgtcttga

KEGG   Rattus norvegicus (rat): 497942
Entry
497942            CDS       T01003                                 

Gene name
Cxcl16
Definition
(RefSeq) C-X-C motif chemokine 16 precursor
  KO
K10035  C-X-C motif chemokine 16
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    497942 (Cxcl16)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    497942 (Cxcl16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    497942 (Cxcl16)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   497942 (Cxcl16)
SSDB
Motif
Pfam: IL8 DUF5134 DUF6535
Other DBs
NCBI-GeneID: 497942
NCBI-ProteinID: NP_001017478
RGD: 1562928
Ensembl: ENSRNOG00000026647
UniProt: Q6AXU5 A0A6M4C4P9
Position
10
AA seq 247 aa
MRRGFGPLALTLFLFFFALLTLPGDGNQGSVAGSCYCDRTIPSGTQIPPATLNHMRKYLK
TFHRCQFFIRFQLQSKSVCGGSQDQWVRELVNCFEHKQCGIGHGQSFHHQKHVPQASTRI
PEATEGKPPDTSTAVQFQSTQQSTFPSGAPSLNKELTRHWETTILPSGYGLEARPVAEAN
EKQHKQQKEPGAGAGTQALVPVLSLLAIVFFLVAAMVCVLCNRRVTRQSSSGLQLCYTPV
EPRPQGL
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaggcggggctttggacccttggcccttacactcttccttttcttctttgcgctgctg
actctgccaggcgatggcaaccagggcagtgtcgctggaagttgctactgtgatcgtaca
attccttctggcacccagataccgcctgctactttgaatcatatgcgaaaatatctgaaa
acgttccatcgctgtcaattctttatcaggttccagttgcagtccaagagtgtgtgtgga
ggaagccaagaccagtgggtccgtgaactagtgaactgctttgagcacaaacaatgtgga
atcggtcatgggcagagttttcaccaccaaaaacatgtgcctcaagccagtacccggatc
cctgaggccacagaagggaaacctccagacacaagcacggctgtacagtttcagagcacc
cagcagtccacttttccatctggagcaccatccttgaacaaagagctcacccgccactgg
gaaacaaccattctcccttcaggctatggtctggaggctaggcctgtggctgaggcaaat
gagaaacagcacaaacagcaaaaagaaccaggagctggtgctggcacacaagccttggtg
ccggtgctatccctcctggccatcgtcttcttcctcgtggcagccatggtctgtgtgctg
tgcaacaggagagtgactcggcagagctcttcaggtttgcagctctgttatacacctgtt
gaaccaagaccccagggcctgtag

KEGG   Rattus norvegicus (rat): 498335
Entry
498335            CDS       T01003                                 

Gene name
Cxcl13
Definition
(RefSeq) C-X-C motif chemokine 13 precursor
  KO
K10032  C-X-C motif chemokine 13
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    498335 (Cxcl13)
   04061 Viral protein interaction with cytokine and cytokine receptor
    498335 (Cxcl13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    498335 (Cxcl13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    498335 (Cxcl13)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   498335 (Cxcl13)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 498335
NCBI-ProteinID: NP_001017496
RGD: 1564256
Ensembl: ENSRNOG00000024899
UniProt: Q5I0J6
Position
14
AA seq 108 aa
MRLCTAALLLLLAICLPPGHGILETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCP
KTEIIFWTKAKKAICVNPTARWLPKVLKFVRRSITSTPQAPVSKKRAA
NT seq 327 nt   +upstreamnt  +downstreamnt
atgaggctctgcaccgcagccctgcttcttctactggccatctgcctccctccaggccac
ggtattctggagacccattacacaaacttgaaatgtaggtgttccaaggtgagctcgacc
tttatcaatctaattctcgtagattggattcaagttatacgccctgggaatggctgcccc
aaaactgaaatcattttctggaccaaggccaagaaagctatatgtgtgaatcctactgcc
agatggttaccaaaagtattaaaatttgtccgaagaagtattacttcaactccccaagct
ccagtgagtaagaaaagagctgcctga

KEGG   Rattus norvegicus (rat): 60665
Entry
60665             CDS       T01003                                 

Gene name
Cxcl6
Definition
(RefSeq) C-X-C motif chemokine 5 precursor
  KO
K05506  C-X-C motif chemokine 5/6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05133  Pertussis
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    60665 (Cxcl6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    60665 (Cxcl6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    60665 (Cxcl6)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    60665 (Cxcl6)
   04062 Chemokine signaling pathway
    60665 (Cxcl6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    60665 (Cxcl6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    60665 (Cxcl6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    60665 (Cxcl6)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   60665 (Cxcl6)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 60665
NCBI-ProteinID: NP_071550
RGD: 708540
Ensembl: ENSRNOG00000002843
UniProt: P97885
Position
14
AA seq 130 aa
MSFQLRSSARIPSRSCSSFTLLAFLLLFTLPQHRAQAAPFSAMVATELRCVCLTLAPRIN
PKMIANLEVIPAGPHCPKVEVIAKLKNQKDNVCLDPQAPLIKKVIQKILGSENKKTKRNA
LALVRSASTQ
NT seq 393 nt   +upstreamnt  +downstreamnt
atgagcttccagctccgcagctccgcccgcatccctagccggtcctgctcgtcattcacc
ctgctggcatttctgctgctgttcacactgccacagcatcgagctcaagctgctcctttc
tcggccatggttgcaacggagctacgctgtgtttgcttaaccttagctccaagaattaac
cccaaaatgatcgctaatttggaggtgatccctgcaggtccacattgccccaaggtggaa
gtcatagctaagttgaagaaccagaaggataatgtttgtcttgacccacaagctccgttg
ataaagaaagtcattcagaaaatattgggcagtgaaaataagaaaacaaagcggaatgca
cttgcactggtcagatcagccagtactcaataa

KEGG   Rattus norvegicus (rat): 685958
Entry
685958            CDS       T01003                                 

Gene name
Ccl26
Definition
(RefSeq) C-C motif chemokine 26 precursor
  KO
K21096  C-C motif chemokine 26
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    685958 (Ccl26)
   04061 Viral protein interaction with cytokine and cytokine receptor
    685958 (Ccl26)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    685958 (Ccl26)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    685958 (Ccl26)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   685958 (Ccl26)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 685958
NCBI-ProteinID: NP_001102958
RGD: 1587817
Ensembl: ENSRNOG00000001444
UniProt: D3ZQG2
Position
12
AA seq 94 aa
MKTFSLGPIVLLAVFLSVQLGVATCESEMPMPCCSYFSHYVIPWHWLYSYQITDSSCPNE
GVIFTTKTGKQYCVQPGDKWVQRYISLLNAKKHW
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaagaccttctctttaggtcccattgttctcctggccgtcttcctcagtgtccagctt
ggtgttgccacgtgtgagagtgaaatgcccatgccctgctgttcctatttcagccactac
gtgatcccgtggcactggctgtacagctaccagatcaccgacagctcctgccccaatgag
ggcgtcatattcaccacaaaaactggtaagcaatactgtgtccagccaggggacaagtgg
gtgcagagatacatttccttgttgaacgccaagaagcattggtga

KEGG   Rattus norvegicus (rat): 688605
Entry
688605            CDS       T01003                                 

Gene name
Ccl1
Definition
(RefSeq) C-C motif chemokine 1 precursor
  KO
K05514  C-C motif chemokine 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    688605 (Ccl1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    688605 (Ccl1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    688605 (Ccl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    688605 (Ccl1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   688605 (Ccl1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 688605
NCBI-ProteinID: NP_001178021
RGD: 1586495
Ensembl: ENSRNOG00000021851
UniProt: D3ZDY4
Position
10
AA seq 92 aa
MKLLNMVLVCLLVAAMWLQNVDSKSMHVVSSRCCLNTLENKIALKFIKCYKEIGPSCPYY
PAVIFRLIKGRESCALTNTTWVQDYLKKVKPC
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaaactcctcaacatggtactggtgtgcctgctggtggctgccatgtggctacagaat
gtggacagcaagagcatgcacgtggtctcctctagatgctgcttgaacaccttggagaac
aagattgccctgaagtttatcaaatgttacaaagagatcggccccagctgtccttactac
ccagctgtaatattcaggctgataaaaggtagagaaagctgcgccttaactaacaccacg
tgggttcaagattacctgaagaaggtgaagccctgctaa

KEGG   Rattus norvegicus (rat): 81503
Entry
81503             CDS       T01003                                 

Gene name
Cxcl1
Definition
(RefSeq) growth-regulated alpha protein precursor
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05134  Legionellosis
rno05146  Amoebiasis
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    81503 (Cxcl1)
   04668 TNF signaling pathway
    81503 (Cxcl1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    81503 (Cxcl1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    81503 (Cxcl1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    81503 (Cxcl1)
   04657 IL-17 signaling pathway
    81503 (Cxcl1)
   04062 Chemokine signaling pathway
    81503 (Cxcl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    81503 (Cxcl1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    81503 (Cxcl1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    81503 (Cxcl1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    81503 (Cxcl1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    81503 (Cxcl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    81503 (Cxcl1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   81503 (Cxcl1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 81503
NCBI-ProteinID: NP_110472
RGD: 619869
Ensembl: ENSRNOG00000002802
UniProt: P14095
Position
14
AA seq 96 aa
MVSATRSLLCAALLLLATSRQATGAPVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCT
QTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK
NT seq 291 nt   +upstreamnt  +downstreamnt
atggtctcagccacccgctcgcttctctgtgcagcgctgctgctgctggccaccagccgc
caagccacaggggcgcccgtcgccaatgagctgcgctgtcagtgcctgcagacagtggca
gggattcacttcaagaacatccagagtttgaaggtgatgccgccaggaccccactgcacc
caaaccgaagtcatagccacactcaagaatggtcgcgaggcttgccttgaccctgaagcc
cccatggttcagaagattgtccaaaagatgctaaagggtgtccccaagtaa

KEGG   Rattus norvegicus (rat): 81780
Entry
81780             CDS       T01003                                 

Gene name
Ccl5
Definition
(RefSeq) C-C motif chemokine 5 precursor
  KO
K12499  C-C motif chemokine 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04668  TNF signaling pathway
rno05020  Prion disease
rno05142  Chagas disease
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    81780 (Ccl5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    81780 (Ccl5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    81780 (Ccl5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    81780 (Ccl5)
   04621 NOD-like receptor signaling pathway
    81780 (Ccl5)
   04623 Cytosolic DNA-sensing pathway
    81780 (Ccl5)
   04062 Chemokine signaling pathway
    81780 (Ccl5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    81780 (Ccl5)
   05168 Herpes simplex virus 1 infection
    81780 (Ccl5)
   05163 Human cytomegalovirus infection
    81780 (Ccl5)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    81780 (Ccl5)
  09163 Immune disease
   05323 Rheumatoid arthritis
    81780 (Ccl5)
  09164 Neurodegenerative disease
   05020 Prion disease
    81780 (Ccl5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    81780 (Ccl5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    81780 (Ccl5)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    81780 (Ccl5)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   81780 (Ccl5)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Chemokines
   81780 (Ccl5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 81780
NCBI-ProteinID: NP_112378
RGD: 69069
Ensembl: ENSRNOG00000010906
Vega: OTTRNOG00000000482
UniProt: Q6PED1
Position
10
AA seq 92 aa
MKISTAASLTVILVAAALCTPAPASPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSN
LAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaagatctccacagctgcatccctcaccgtcatcctcgttgcagccgccctctgcacc
cccgcacctgcctccccatatggctcggacaccactccctgctgctttgcctacctctcc
ctcgcactgccccgtgcccacgtgaaggagtatttttacaccagcagcaagtgctccaac
cttgcagtcgtctttgtcactcgaaggaaccgccaagtgtgtgccaacccagagaagaag
tgggttcaagaatacatcaactatttggagatgagctag

KEGG   Rattus norvegicus (rat): 89808
Entry
89808             CDS       T01003                                 

Gene name
Cx3cl1
Definition
(RefSeq) fractalkine precursor
  KO
K05508  C-X3-C motif chemokine 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04668  TNF signaling pathway
rno05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    89808 (Cx3cl1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    89808 (Cx3cl1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    89808 (Cx3cl1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    89808 (Cx3cl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    89808 (Cx3cl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    89808 (Cx3cl1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   89808 (Cx3cl1)
SSDB
Motif
Pfam: IL8 CCDC84
Other DBs
NCBI-GeneID: 89808
NCBI-ProteinID: NP_604450
RGD: 620458
Ensembl: ENSRNOG00000016326
UniProt: O55145
Position
19
AA seq 393 aa
MAPSQLAWLLRLAAFFHLCTLLAGQHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGK
RAIILETRQHRHFCADPKEKWVQDAMKHLDHQTAALTRNGGKFEKRVDNVTPRITSTTRG
LSPTALAKPESATVEDLTLEPTAISQEARRPMGTSQEPPAAVTGSFPSTSKAQDAGLAAK
PQSTGISEVAAVSTTIWPSSAVYQSGSSLWAEEKATESPPTIALSTQVSTTSSPKQNVGS
EGQPPWVQEQDSTPEKSPGPEETNPVHTDIFQDRGPGSTVHPSVAPTSSEKTPSPELVAS
GSQAPKVEEPIHATADPQKLSVFITPVPDSQAATRRQAVGLLAFLGLLFCLGVAMFAYQS
LQGCPRKMAGEMVEGLRYVPRSCGSNSYVLVPV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggctccctcacagctcgcgtggctgctgcgcctggccgcgttctttcatctgtgtact
ctgctggcgggtcagcacctcggcatgacgaaatgcaacatcacgtgccacaagatgacc
tcgccaatcccggtgaccttgctcatccactatcaactgaaccaggagtcctgcggcaag
cgcgccatcatcctggagacgagacagcacagacacttctgtgctgacccaaaggagaaa
tgggtccaagacgccatgaagcacctggaccaccagaccgctgccctgactagaaatggt
ggcaagtttgagaagcgtgtggacaatgtgacacctaggatcacctcgaccaccagggga
ctgtccccaactgccctggcaaagcctgagtcagccacagtggaagaccttactttggaa
ccgactgctatttcccaggaggcccgaaggcccatggggacttcccaagagccaccagca
gcagtgactggatcgtttccctcaacttccaaagctcaggatgcagggcttgccgccaag
cctcagagcactggaatttctgaggtggctgctgtctctaccaccatttggccgagttct
gctgtctaccaatctggatctagcctctgggccgaggaaaaagctactgaatcccccccc
actatagccctgtctactcaagtgtccaccacttcaagccccaagcagaatgttgggtct
gaaggccagcccccatgggtccaggagcaggactccactccagagaaatctccagggcct
gaggagacaaacccagttcatactgatattttccaagacagaggacctggcagcacagtc
catccctcagtggctcccacctcctctgaaaagacccccagcccagagctggtggcctcg
ggcagccaggctcctaaggtagaggaacccattcatgccactgcagatccccagaaactg
agtgtgtttatcactcctgtccctgactcccaggcagccacccggaggcaggcagtgggg
ttactggcctttcttggtctactcttctgtctgggggtggccatgtttgcctaccagagc
ctccagggctgtccccgcaaaatggcaggggagatggtggaaggcctccgctacgtcccc
cgtagctgtggcagtaactcgtacgtcctggtgccggtgtga

DBGET integrated database retrieval system