KEGG   Rattus norvegicus (rat): 114105
Entry
114105            CDS       T01003                                 

Gene name
Cxcl2
Definition
(RefSeq) C-X-C motif chemokine 2 precursor
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05134  Legionellosis
rno05146  Amoebiasis
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    114105 (Cxcl2)
   04668 TNF signaling pathway
    114105 (Cxcl2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114105 (Cxcl2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    114105 (Cxcl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114105 (Cxcl2)
   04657 IL-17 signaling pathway
    114105 (Cxcl2)
   04062 Chemokine signaling pathway
    114105 (Cxcl2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    114105 (Cxcl2)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    114105 (Cxcl2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    114105 (Cxcl2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    114105 (Cxcl2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    114105 (Cxcl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    114105 (Cxcl2)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   114105 (Cxcl2)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 114105
NCBI-ProteinID: NP_446099
RGD: 70069
Ensembl: ENSRNOG00000002792
UniProt: P30348
Position
14
AA seq 100 aa
MAPPTRQLLNAVLVLLLLLATNHQGTGVVVASELRCQCLTTLPRVDFKNIQSLTVTPPGP
HCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN
NT seq 303 nt   +upstreamnt  +downstreamnt
atggcccctcccactcgccagctcctcaatgctgtactggtcctgctcctcctgctggcc
accaaccatcagggtacaggggttgttgtggccagtgagctgcgctgtcaatgcctgacg
accctaccaagggttgacttcaagaacatccagagcttgacggtgacccctccaggaccc
cactgcgcccagacagaagtcatagccactcttaaggatggtcatgaagtttgtctcaac
cctgaagcccccttggttcagaggatcgtccaaaagatactgaacaaaggcaaggctaac
tga

KEGG   Rattus norvegicus (rat): 171551
Entry
171551            CDS       T01003                                 

Gene name
Cxcl3
Definition
(RefSeq) C-X-C motif chemokine 3 precursor
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05134  Legionellosis
rno05146  Amoebiasis
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    171551 (Cxcl3)
   04668 TNF signaling pathway
    171551 (Cxcl3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    171551 (Cxcl3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    171551 (Cxcl3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    171551 (Cxcl3)
   04657 IL-17 signaling pathway
    171551 (Cxcl3)
   04062 Chemokine signaling pathway
    171551 (Cxcl3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    171551 (Cxcl3)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    171551 (Cxcl3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    171551 (Cxcl3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    171551 (Cxcl3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    171551 (Cxcl3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    171551 (Cxcl3)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   171551 (Cxcl3)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 171551
NCBI-ProteinID: NP_612531
RGD: 621812
Ensembl: ENSRNOG00000028043
UniProt: Q10746
Position
14
AA seq 100 aa
MAPPTRRLLNAALLLLLLLMATSHQPSGTVVARELRCQCLKTLPRVDFENIQSLTVTPPG
PHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSPSL
NT seq 303 nt   +upstreamnt  +downstreamnt
atggcccctcccacccgccggctcctcaatgctgcactgcttctgctgcttctgctgatg
gccaccagccaccagccttcagggactgttgtggcccgtgagctgcgctgtcagtgcctg
aagaccctaccaagggttgattttgagaacatccagagcttgacggtgacccctccagga
ccgcactgcacccagacagaagtcatagccactctcaaggatggtcaagaagtttgtctc
aaccctcaagctcccaggcttcagaaaatcatccagaagttactgaagagcccctccctg
tga

KEGG   Rattus norvegicus (rat): 81503
Entry
81503             CDS       T01003                                 

Gene name
Cxcl1
Definition
(RefSeq) growth-regulated alpha protein precursor
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05134  Legionellosis
rno05146  Amoebiasis
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    81503 (Cxcl1)
   04668 TNF signaling pathway
    81503 (Cxcl1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    81503 (Cxcl1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    81503 (Cxcl1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    81503 (Cxcl1)
   04657 IL-17 signaling pathway
    81503 (Cxcl1)
   04062 Chemokine signaling pathway
    81503 (Cxcl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    81503 (Cxcl1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    81503 (Cxcl1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    81503 (Cxcl1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    81503 (Cxcl1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    81503 (Cxcl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    81503 (Cxcl1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   81503 (Cxcl1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 81503
NCBI-ProteinID: NP_110472
RGD: 619869
Ensembl: ENSRNOG00000002802
UniProt: P14095
Position
14
AA seq 96 aa
MVSATRSLLCAALLLLATSRQATGAPVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCT
QTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK
NT seq 291 nt   +upstreamnt  +downstreamnt
atggtctcagccacccgctcgcttctctgtgcagcgctgctgctgctggccaccagccgc
caagccacaggggcgcccgtcgccaatgagctgcgctgtcagtgcctgcagacagtggca
gggattcacttcaagaacatccagagtttgaaggtgatgccgccaggaccccactgcacc
caaaccgaagtcatagccacactcaagaatggtcgcgaggcttgccttgaccctgaagcc
cccatggttcagaagattgtccaaaagatgctaaagggtgtccccaagtaa

DBGET integrated database retrieval system