KEGG   Rattus norvegicus (rat): 114107
Entry
114107            CDS       T01003                                 

Gene name
Kremen1, Kremen
Definition
(RefSeq) kringle containing transmembrane protein 1
  KO
K23091  kremen protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    114107 (Kremen1)
SSDB
Motif
Pfam: Kringle WSC CUB
Other DBs
NCBI-GeneID: 114107
NCBI-ProteinID: NP_446101
RGD: 620789
Ensembl: ENSRNOG00000051487
UniProt: Q924S4
Position
14q21
AA seq 473 aa
MAPPAARLALLSAAALTLAARPAPGPRPSPECFTANGADYRGTQSWTALQGGKPCLFWNE
TFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNL
GCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKHGE
AASTECNNVCFGDHTQPCGGDGRIILFDTLVGACGGNYSSMAAVVYSPDFPDTYATGRVC
YWTIRVPGASRIHFNFTIFDIRDSADMVELLDGYTHRVLVRFDGRSRPPLSFNVSLDFVI
LYFFSDRINQAQGFAVLYQATKEEPPQERPAINQTLAEVITEQANLSVSAAHSSKVLYVI
TSSPSHPPQTVPGSHSWVPSVGASGHRVEGWTVYGLATLLILTVTAVVAKILLHVTFKSH
RVTASGDLRDCRQPGTSGEIWTIFYEPSTTISIFKKKLKGQSQQDDRNPLVSD
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggcgccgcccgccgcccgcctcgcgctgctctccgccgctgcgctcactctggcggcc
cggcccgcacccggtccccgccccagccccgagtgtttcacagccaatggtgcagattat
aggggaacacagagctggacagcactgcaaggtggcaagccatgtctgttctggaacgag
actttccagcatccatacaacacactgaaataccccaacggggaaggaggtctgggtgag
cataactattgcagaaatccagatggagatgtgagcccttggtgctacgtggcagagcat
gaggatggcgtctactggaagtactgtgaaattcctgcgtgtcagatgcctggaaacctt
ggctgctacaaggatcatggaaacccacctcctctcacgggcaccagtaagacgtccaac
aagctcaccatccaaacctgtatcagcttttgtcggagtcagagattcaagtttgctggg
atggagtcaggctacgcatgcttctgtgggaataatcctgactactggaagcacggggag
gcagccagcaccgagtgcaataatgtctgcttcggggaccacacgcagccctgcggtggg
gacggcaggattatcctctttgacactctcgtgggcgcctgcggtgggaactactcctcc
atggcagctgtggtctactctcctgacttccctgacacctacgccactgggagggtctgc
tactggactatccgggttccaggagcctctcgcatccatttcaacttcacgatattcgat
atcagggattctgcagacatggtggagctgctggacggctacacccaccgcgtcctggtc
cgcttcgacggcaggagccgtccacctctgtccttcaatgtctctctggacttcgtcatt
ttatatttcttctctgatcgcatcaaccaggcccagggatttgctgtcttgtaccaagcc
accaaggaagaacctccacaggagaggcctgctatcaaccagaccctggcagaggtgatc
acggaacaagccaacctcagcgtcagcgctgcccactcttccaaagtcctctatgtcatc
acctccagccccagccacccaccgcagaccgtcccaggtagccattcctgggtaccatca
gttggggccagcggccacagagtggaaggatggaccgtgtatggcctggccaccctcctc
atcctcacagtcacagccgttgtggcaaagatccttctgcacgtgacgtttaaatctcat
cgagttactgcttcaggagaccttagggactgtcgccagcctgggacttctggggagatc
tggaccattttctatgaaccctccactacaatctctatctttaagaagaagctcaagggt
cagagtcaacaagatgaccgtaaccccctcgtgagtgactga

DBGET integrated database retrieval system