KEGG   Rattus norvegicus (rat): 114108Help
Entry
114108            CDS       T01003                                 

Gene name
Pdlim3, Actn2lp, Alp
Definition
(RefSeq) PDZ and LIM domain 3
  KO
K23353  PDZ and LIM domain protein 1/2/3/4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    114108 (Pdlim3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4749 PDZ LIM PDZ_6 PDZ_2 Lar_restr_allev
Motif
Other DBs
NCBI-GeneID: 114108
NCBI-ProteinID: NP_446102
RGD: 620427
Ensembl: ENSRNOG00000012658
UniProt: Q66HS7
Position
16q11
AA seq 362 aa AA seqDB search
MPQNVVLPGPASWGFRLSGGIDFNQPLVITRITPGSKAEAANLCPGDMILAIDGFGTESM
THADAQDRIKAASYQLCLKIDRAETRLCPAVSEDGKAHPFKINLEAEPQDVNYFEHKHNI
RPKPFIIPGRTSGCSTPSGIDCGSGRSTPSSVSTVSTICPGDLKVAAKMAPNIPLEMELP
GVKIVHAQFNTPMQLYSDDNIMETLQGQVSTALGETPSMSEPTASVPPQSDVYRMLHDNR
DEPAAPRQSGSFRVLQELVNDGSDDRPAGTRSVRPVTKVHGGAGGAQRMPLCDKCGSGIV
GAVVKARDKYRHPECFVCADCNLNLKQKGYFFVEGELYCEMHARARARPPEGYDTVTLYP
KA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgccccaaaacgtagttctcccgggccctgcgtcctgggggttcagactctcaggaggc
atagacttcaaccagcctttggtcatcaccaggatcactccgggaagcaaggcagaagcc
gccaacctgtgccctggcgacatgatactggctatcgatggctttggtacggagtccatg
actcatgctgatgctcaggacaggatcaaagcagcatcttaccagttgtgtctcaagatt
gacagggcagaaactcgcttatgtcccgcagtgtcggaagatgggaaagcgcatcccttt
aaaatcaacctagaggctgaaccgcaggatgtgaactactttgaacacaagcacaatatt
cggcccaaacctttcataattccaggccgaaccagtggctgcagcactccttccggtatt
gactgtggcagtggacgtagcaccccttcttccgtcagtaccgttagtacgatctgccca
ggtgacttgaaagttgctgctaagatggcccctaacattcctttggaaatggaacttccg
ggcgtgaagattgtacatgctcagtttaacactcctatgcagttgtactcagatgacaat
attatggaaacacttcagggtcaggtttccacagctctaggggagacaccctccatgagt
gaacccacagcttcagttccccctcagtcggacgtgtaccgaatgctgcacgacaatcgg
gatgaaccagctgctcctcgccagtcaggctccttcagggtcctgcaggagctggtgaac
gacgggtctgatgaccgtcctgctggaactcgaagtgtgaggccggttactaaagtccat
ggcggggctggcggtgcccagaggatgccactctgtgacaagtgtggcagtggtattgta
ggtgctgtggtcaaggcccgggataagtaccggcaccccgagtgctttgtgtgtgctgac
tgtaacctcaacctcaagcagaaaggttacttcttcgtggagggggagctgtattgtgag
atgcacgcaagagcccgggcgaggcccccagaaggctacgacaccgtcactctgtacccc
aaagcttaa

DBGET integrated database retrieval system