KEGG   Rattus norvegicus (rat): 114108
Entry
114108            CDS       T01003                                 

Gene name
Pdlim3
Definition
(RefSeq) PDZ and LIM domain protein 3
  KO
K23353  PDZ and LIM domain protein 1/2/3/4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    114108 (Pdlim3)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 LIM domain-containing proteins
  PDZ-LIM family proteins
   114108 (Pdlim3)
SSDB
Motif
Pfam: DUF4749 PDZ LIM PDZ_6 PDZ_2
Other DBs
NCBI-GeneID: 114108
NCBI-ProteinID: NP_446102
RGD: 620427
Ensembl: ENSRNOG00000012658
UniProt: Q66HS7
Position
16
AA seq 364 aa
MPQNVVLPGPAPWGFRLSGGIDFNQPLVITRITPGSKAEAANLCPGDVILAIDGFGTESM
THADAQDRIKAASYQLCLKIDRAETRLWSPQVSEDGKAHPFKINLEAEPQDVNYFEHKHN
IRPKPFIIPGRTSGCSTPSGIDCGSGRSTPSSVSTVSTICPGDLKVAAKMAPNIPLEMEL
PGVKIVHAQFNTPMQLYSDDNIMETLQGQVSTALGETPSMSEPTASVPPQSDVYRMLHDN
RDEPAAPRQSGSFRVLQELVNDGSDDRPAGTRSVRAPVTKVHGGAGGAQRMPLCDKCGSG
IVGAVVKARDKYRHPECFVCADCNLNLKQKGYFFVEGELYCEMHARARTRPPEGYDTVTL
YPKA
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgccccaaaacgtagttctcccgggccctgcgccctggggcttcagactctcaggaggc
atagacttcaaccagcctttggtcatcaccaggatcactccgggaagcaaggcagaagcc
gccaacctgtgccctggagacgtcatcctggctatcgatggctttggtacggagtccatg
actcatgctgatgctcaggacaggatcaaagcagcatcttaccagttgtgtctcaagatt
gacagggcagaaactcgcttatggtccccgcaggtgtcggaagatgggaaagcgcatccc
tttaaaatcaacctagaggctgaaccgcaggatgtgaactactttgaacacaagcacaat
attcggcccaaacctttcataattccaggccgaaccagtggctgcagcactccttccggt
attgactgtggcagtggacgtagcaccccttcttccgtcagtaccgttagtacgatctgc
ccaggtgacttgaaagttgctgctaagatggcccctaacattcctttggaaatggaactt
ccgggcgtgaagattgtacatgctcagtttaacactcctatgcagttgtactcagatgac
aatattatggaaacacttcagggtcaggtttccacagctctaggggagacaccctccatg
agtgaacccacagcttcagttccccctcagtcggacgtgtaccgaatgctgcacgacaat
cgggatgaaccagctgctcctcgccagtcaggctccttcagggtcctgcaggagctggtg
aacgacgggtctgatgaccgtcctgctggaactcgaagtgtgagggctccggttactaaa
gtccatggcggggctggcggtgcccagaggatgccactctgtgacaagtgtggcagtggt
attgtaggtgctgtggtcaaggcccgggataagtaccggcaccccgagtgctttgtgtgt
gctgactgtaacctcaacctcaagcagaaaggttacttcttcgtggagggggagctgtat
tgtgagatgcacgcaagagcccgcacgaggcccccagaaggctacgacaccgtcactctg
taccccaaagcttaa

DBGET integrated database retrieval system