KEGG   Rattus norvegicus (rat): 114109Help
Entry
114109            CDS       T01003                                 

Gene name
Nkx2-5, Csx, Nkx2.5
Definition
(RefSeq) NK2 homeobox 5
  KO
K09345  homeobox protein Nkx-2.5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    114109 (Nkx2-5)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    114109 (Nkx2-5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homez Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 114109
NCBI-ProteinID: NP_446103
RGD: 620520
Ensembl: ENSRNOG00000020747
UniProt: O35767
Position
10q12
AA seq 318 aa AA seqDB search
MFPSPALTHTPFSVKDILNLEQQQRSLAAGDLSARLEATLAPASCMLAAFKPDGYSGPEA
AAPGLAELRAELGPAPSPPKCSPAFPTAPTFYPRAYGDPDPAKDPRADKKELCALQKAVE
LDKAETDGAERRRPRRRRKPRVLFSQAQVYELERRFKQQRYLSPAERDQLASVLKLTSTQ
VKIWFQNRRYKCKRQRQDQTLELLGPPPPPARRIAVPVLVRDGKPCLGDSAAYAPAYGLG
LNAYGYNAYPYPGYGGAACSPAYSCAAYPAAPPAAHAPAASANSNFVNFGVGDLNTVQSP
GMPQGNSGVSTLHGIRAW
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttccccagccctgcgctcacacacacgcccttctcagtcaaagacatcctgaacctg
gagcagcagcagcgcagcctggcggctggggacctgtctgcgcgcctcgaggccaccctg
gcgcccgcctcctgcatgctggccgccttcaagccggacggctactcaggccccgaggcg
gcagcgcccggcctggcagagctgcgcgcggagctgggccccgcgccttcgccccccaag
tgctctcctgctttcccaaccgcccctacattttatccgcgagcctacggtgaccctgac
cccgccaaggaccctcgggcggataagaaagagctgtgcgcgctgcagaaggcggtggag
ctggacaaagccgagacagacggcgccgagaggcgacgaccacggcggcgacggaagcca
cgcgtgctcttctcgcaggcgcaggtctatgagctggagcggcgcttcaagcaacagcgg
tacctgtcgcccgctgagcgcgaccaactggccagcgtgctgaagctcacgtccacgcag
gtcaagatctggttccagaaccgccgctacaagtgtaagcgacagcggcaggaccagact
ctggagctgctggggccgccgccgccgcccgcgcgcaggatcgcggtgccggtgttggtg
cgcgacgggaagccctgcctgggggactcggcggcctacgctcccgcctacggcctgggt
ctcaacgcctacggctacaacgcctacccctatcccggctacggtggcgcggcctgcagt
cccgcctacagctgcgccgcgtaccccgccgcgccccccgccgcgcacgccccagccgcc
agcgccaacagcaacttcgtgaactttggcgtcggggacttgaacacggtgcagagtccc
gggatgccacagggcaattcgggcgtctccacgctgcacggcatccgagcctggtag

DBGET integrated database retrieval system