KEGG   Rattus norvegicus (rat): 114110
Entry
114110            CDS       T01003                                 

Gene name
Flt4
Definition
(RefSeq) vascular endothelial growth factor receptor 3 precursor
  KO
K05097  FMS-like tyrosine kinase 4 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno05200  Pathways in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114110 (Flt4)
   04014 Ras signaling pathway
    114110 (Flt4)
   04015 Rap1 signaling pathway
    114110 (Flt4)
   04020 Calcium signaling pathway
    114110 (Flt4)
   04151 PI3K-Akt signaling pathway
    114110 (Flt4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114110 (Flt4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114110 (Flt4)
  09162 Cancer: specific types
   05224 Breast cancer
    114110 (Flt4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    114110 (Flt4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     114110 (Flt4)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   114110 (Flt4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set C1-set TCAD9 Haspin_kinase
Other DBs
NCBI-GeneID: 114110
NCBI-ProteinID: NP_446104
RGD: 621737
Ensembl: ENSRNOG00000002511
UniProt: Q91ZT1
Position
10
AA seq 1363 aa
MQPGAALNLRLWLCLGLLQGLANGYSMTPPTLNITEDSYVIDTGDSLSISCRGQHPLEWT
WPGAQEVLTTGGKDSEDTQVVQDCEGTEARPYCKVLSLAQTHANNTGSYYCYYKYIKARI
EGTTAASTYVFVRDFEQPFINKPDTLLVNRKDSMWVPCLVSIPGLNITLRSQSSVLHPDG
QEVLWDDRRGMRVPTLLLRDALYLQCETTWGDQDFLSNPFLVHITGNELYDIQLYPKKSL
ELLVGEKLVLNCTVWAEFDSGVTFDWDYPGKQAERAKWVPERRSQQTHTELSSILTIHNV
SQHDLGPYVCEANNGIQRFRESTEVIVHEKPFISVEWLKGPVLEATAGDEMVKLPVKLAA
YPPPEFQWYKDRKAVTGRHNPHALVLKEVTEASAGVYTLALWNSAAGLRQNISLELVVNV
PPHIHEKEASSPSIYSRHSRQTLTCTTYGVPQPLSVQWHWRPWTPCKTFAQRSLRRRQPR
DGMPQCRDWKEVTTQDAVNPIESLDTWTESVEGKNKTVSKLVIQDANVSAMYKCVVFNKV
GQDERLIYFYVTTIPDGFSIESEPSEDPLEGQSVRLSCRADNYTYEHLRWYRLNLSTLHD
AQGNPLLLDCKNVHLFATPLEANLEEAEPGARHATLSLNIPRVAPEDEGDYVCEVQDRRN
QDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMRCPVAGAHVPSIVWYKDERLLEK
ESGIDLADSNQRLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVILI
GTGVIAVFFWVLLLLIFCNMKRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDVSQWEF
PRERLHLGRVLGHGAFGKVVEASAFGINKGSSCDTVAVKMLKEGATASEHRALMSELKIL
IHIGNHLNVVNLLGACTKPNGPLMVIVEFCKYGNLSNFLRVKRETFDPYAEKSPEQRRRF
RAMVEGAKADRRRLGSTDRALFTRFLMGKGSARRAPFVQEAEDLWLSPLTMEDLVCYSFQ
VALGMEFLASRKCIHRDLAARNILLSESDIVKICDFGLARDIYKDPDYVRKGSARLPLKW
MAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLKDGTRMRAPELA
TPAIRHIMQSCWSGDPKARPAFSDLVEILGDLLQGGGWQEEEEECMALHSSQSSEEDGFM
QASTTALHITEADAESSPPSMHCHSLAARYYNCVSFPGRLVRGTKAPGSSRMKTFEELPM
TPTTYKASVDNQTDSGMVLASEEFEQIESRHRQEGSFSRKDPGQHMDISRGHPDLQGRRR
RPTQGAQGGKVFYNNEYGEVSQPCTEGDCCPSAGSTFFADSNY
NT seq 4092 nt   +upstreamnt  +downstreamnt
atgcagccgggcgctgcgctgaacctgcgcctgtggctctgcctcggactcctccaaggc
ctggcaaatggctactccatgacccctccaactctgaacatcacagaggattcatatgtc
attgacaccggggacagcctatccatatcctgcagggggcagcaccccctcgagtggacc
tggccaggggcccaagaggtactgaccacaggtgggaaggacagcgaggacacgcaggtt
gtgcaagactgtgaaggcacagaagctaggccctactgcaaggtgctgtcgctggcccag
actcacgccaacaacacaggcagctattactgctactacaagtatatcaaggcccggatt
gagggcaccacagctgccagcacctatgtgtttgtaagagactttgaacagcctttcatc
aacaaacctgacacgctcctggtcaacaggaaggactcgatgtgggtgccctgcttggtg
tccattcccgggctcaacatcacactgcgctcgcaaagttcggtgctgcaccctgatggg
caggaggtgttgtgggacgaccgccggggcatgcgggtgcccactctactgttgcgtgac
gccctgtacctgcagtgcgagaccacctggggagaccaggacttcctttccaatcccttc
ctcgtgcacatcacaggcaatgagctctatgacatccagctgtaccccaagaagtcactg
gagctgttggttggagagaagctggttttgaactgtacagtatgggctgagttcgactct
ggtgtcaccttcgactgggattacccaggaaagcaggcagagcgtgctaagtgggtacct
gagcggcgttcccagcagacccacacggaactctccagcatcctgaccatccacaatgtc
agccagcacgacctgggcccctatgtgtgtgaggccaacaatgggattcagcggttccgg
gaaagcacggaggtcattgtgcacgaaaagcccttcatcagtgtcgagtggctcaaagga
cctgtcctggaggccacagccggtgacgagatggtgaagctgcccgtgaagcttgcagct
tatcccccaccggagttccaatggtacaaggacagaaaggcagtgactgggcgccacaat
ccacatgctctggtgctcaaagaggtgaccgaggccagtgcaggcgtctacaccctcgcc
ctgtggaactctgcagccggtctgaggcagaatatcagtctggagctggtggtgaatgtg
ccgccccacatccatgaaaaggaagcttcttcacccagcatctactcccgccacagccgc
cagaccctcacctgcaccacctatggggtaccccaacctctcagtgttcagtggcactgg
aggccctggacaccctgtaagacatttgcccagcgcagtctccggaggcggcagccgcgg
gatggcatgccacagtgccgagactggaaggaggtgaccactcaggacgctgtgaacccc
atcgagagcctggacacctggaccgagtctgtggagggcaagaacaagacggtgagcaag
ctggtgattcaggatgccaatgtgtcagccatgtacaaatgcgtggtcttcaacaaagtg
ggccaggacgagcggctcatctacttctatgtgaccaccatccctgacggcttcagtatc
gaatcagagccatccgaggatcccttagaaggccagtccgtgcgcctcagctgccgggcg
gacaactacacgtatgagcatctgcgctggtaccggctcaacctctccacgctgcacgac
gctcaagggaacccactactgctcgactgcaagaacgtgcacctgtttgccacgccccta
gaggccaacctagaggaggcggagcctggggcccgccacgccaccctcagcttgaatatc
ccccgagtggcgcccgaggacgagggtgactacgtgtgtgaggtgcaagataggcgcaac
caagacaagcactgccacaagaaatacctgtccgtacaggccctggaagctcctcggctc
acgcagaacttgaccgacctcctggtgaacgtgagtgactccctggagatgcgatgtccg
gtagccggagcacatgtgcccagtattgtgtggtacaaagatgaaaggctcctggagaaa
gagtcgggaatcgacctggcagactccaatcagaggctgagcatccaacgcgtgcgcgag
gaggacgcgggtcgttacctgtgcagtgtgtgcaatgccaagggctgcgtaaactcctcc
gccagcgtggccgtagaaggctcggaagataaaggcagcatggagattgtgatactcatt
ggcactggcgtcatcgcagtcttcttctgggtcctcctcctgctcatcttctgtaacatg
aaaaggcctgcccatgcagacatcaagacgggctacctgtccatcatcatggaccccggg
gaggtgcctttggaggagcagtgtgaatacctgtcctatgacgtcagccagtgggagttc
cccagggaaaggttgcacctcgggagagtcctaggccatggggcttttgggaaggtggtg
gaagcctcagcctttggcatcaataaaggcagcagctgtgataccgtggcggtgaagatg
ctgaaagagggcgctactgccagcgaacaccgtgccctgatgtccgagctcaagatccta
attcacatcggtaaccacctcaatgtggtcaacctcctaggggcgtgcaccaagcccaat
ggccctctcatggtgatcgtggagttttgcaaatacggcaacctctccaacttcttgcgt
gtcaagcgggagacgttcgacccctacgcagagaagtctcccgagcaacgcaggcgcttc
cgcgcgatggtagaaggcgccaaggctgataggaggagacttggaagcaccgacagagcc
ctgtttacaaggttcctgatgggcaaaggaagtgcacggcgagccccatttgtccaagaa
gctgaggacctgtggttgagcccgctgaccatggaggaccttgtctgctacagtttccaa
gtggccctgggaatggagttcctggcttcccgcaagtgcattcacagagacctggctgct
cggaacattttactgtcagaaagtgacatagtgaagatctgtgactttggcctcgctcgg
gacatctacaaagaccctgactatgtccgaaagggcagcgcccgactgcctctgaaatgg
atggcccccgagagcatcttcgataaggtgtacaccacgcagagtgatgtgtggtccttc
ggagtgctgctgtgggagattttctcactgggggcctctccataccctggggtacagatc
aatgaggaattctgccagcggctgaaagacggcacacgaatgagggccccagaactggcc
actcctgccatacgccacatcatgcagagttgctggtctggagaccctaaagcgaggcct
gctttctctgacctagtggagatcctgggggacctgcttcagggtggaggctggcaggag
gaggaggaggaatgcatggccctgcacagttctcagagctcagaggaggatggcttcatg
caggcatccaccacagctctacatatcacggaggctgacgctgagagcagtccacccagc
atgcattgccacagcctggcagccagatattacaactgtgtgtcctttcctgggcgcctg
gtcagggggactaaggctccaggttcctccaggatgaagacgtttgaagaattgcccatg
acccctacaacctacaaagcctctgtggataaccaaacagacagcgggatggtgctggcc
tcagaagagtttgagcagatagaaagcaggcatagacaagaaggcagcttcagccgtaaa
gatcctggccagcacatggatatttccagaggacacccggacctccaggggaggcggcga
cggcccacccagggggcacaaggaggcaaggtgttttacaacaacgagtatggggaggtc
tcccagccgtgtacagaaggtgactgctgcccgtctgctggctccaccttcttcgcagac
agcaactactaa

KEGG   Rattus norvegicus (rat): 24329
Entry
24329             CDS       T01003                                 

Gene name
Egfr
Definition
(RefSeq) epidermal growth factor receptor precursor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04072  Phospholipase D signaling pathway
rno04144  Endocytosis
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04520  Adherens junction
rno04540  Gap junction
rno04630  JAK-STAT signaling pathway
rno04810  Regulation of actin cytoskeleton
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno05160  Hepatitis C
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24329 (Egfr)
   04012 ErbB signaling pathway
    24329 (Egfr)
   04014 Ras signaling pathway
    24329 (Egfr)
   04015 Rap1 signaling pathway
    24329 (Egfr)
   04630 JAK-STAT signaling pathway
    24329 (Egfr)
   04066 HIF-1 signaling pathway
    24329 (Egfr)
   04068 FoxO signaling pathway
    24329 (Egfr)
   04020 Calcium signaling pathway
    24329 (Egfr)
   04072 Phospholipase D signaling pathway
    24329 (Egfr)
   04151 PI3K-Akt signaling pathway
    24329 (Egfr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    24329 (Egfr)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24329 (Egfr)
   04520 Adherens junction
    24329 (Egfr)
   04540 Gap junction
    24329 (Egfr)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24329 (Egfr)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    24329 (Egfr)
   04915 Estrogen signaling pathway
    24329 (Egfr)
   04921 Oxytocin signaling pathway
    24329 (Egfr)
   04926 Relaxin signaling pathway
    24329 (Egfr)
   04928 Parathyroid hormone synthesis, secretion and action
    24329 (Egfr)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24329 (Egfr)
   05206 MicroRNAs in cancer
    24329 (Egfr)
   05205 Proteoglycans in cancer
    24329 (Egfr)
   05230 Central carbon metabolism in cancer
    24329 (Egfr)
   05231 Choline metabolism in cancer
    24329 (Egfr)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    24329 (Egfr)
  09162 Cancer: specific types
   05210 Colorectal cancer
    24329 (Egfr)
   05212 Pancreatic cancer
    24329 (Egfr)
   05225 Hepatocellular carcinoma
    24329 (Egfr)
   05226 Gastric cancer
    24329 (Egfr)
   05214 Glioma
    24329 (Egfr)
   05218 Melanoma
    24329 (Egfr)
   05219 Bladder cancer
    24329 (Egfr)
   05215 Prostate cancer
    24329 (Egfr)
   05213 Endometrial cancer
    24329 (Egfr)
   05224 Breast cancer
    24329 (Egfr)
   05223 Non-small cell lung cancer
    24329 (Egfr)
  09172 Infectious disease: viral
   05160 Hepatitis C
    24329 (Egfr)
   05171 Coronavirus disease - COVID-19
    24329 (Egfr)
   05163 Human cytomegalovirus infection
    24329 (Egfr)
   05165 Human papillomavirus infection
    24329 (Egfr)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    24329 (Egfr)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24329 (Egfr)
   01522 Endocrine resistance
    24329 (Egfr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24329 (Egfr)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24329 (Egfr)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     24329 (Egfr)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   24329 (Egfr)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   24329 (Egfr)
  Exosomal proteins of pancreatic cancer cells
   24329 (Egfr)
  Exosomal proteins of bladder cancer cells
   24329 (Egfr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like ABC1
Other DBs
NCBI-GeneID: 24329
NCBI-ProteinID: NP_113695
RGD: 2543
Ensembl: ENSRNOG00000004332
UniProt: Q9QX70
Position
14
AA seq 1209 aa
MRPSGTARTKLLLLLAALCAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYALA
VLSNYGTNKTGLRELPMRNLQEILIGAVRFSNNPILCNMETIQWRDIVQDVFLSNMSMDV
QRHLTGCPKCDPSCPNGSCWGRGEENCQKLTKIICAQQCSRRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCHRFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGPDYYEVEEDGVSKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK
YCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPENWTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIISGNRNLCYANTINWKKL
FGTPNQKTKIMNNRAEKDCKATNHVCNPLCSSEGCWGPEPTDCVSCQNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQTMNITCTGRGPDNCIKCAHYVDGPHCVKTCPSGIM
GENNTLVWKFADANNVCHLCHANCTYGCAGPGLKGCQQPEGPKIPSIATGIVGGLLFIVV
VALGIGLFMRRRQLVRKRTLRRLLQERELVEPLTPSGEAPNQAHLRILKETEFKKIKVLG
SGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLG
ICLTSTVQLITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLA
ARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWS
YGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRP
KFRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMEEEDMEDVVDADEYLIP
QQGFFNSPSTSRTPLLSSLSANSNSSTVACINRNGSCRVKEDAFLQRYSSDPTSVLTEDN
IDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVSNPEYLNT
AQPTCLSSGFDSSALWIQKGSHQMSLDNPDYQQDFFPKEAKPNGIFKGPTAENAEYLRVA
PPSSEFSGA
NT seq 3630 nt   +upstreamnt  +downstreamnt
atgcgaccctcagggactgcgagaaccaagctactgctgctgctggctgcgctctgcgcc
gcaggtggggcgctggaggaaaagaaagtttgccaaggcacaagtaacaggctcacccaa
ctaggcacctttgaagaccactttctgagcctccagaggatgttcaacaactgtgaagtg
gtccttggaaacttggaaatcacctatgtgcaaaggaattatgacctttccttcttaaag
accatccaggaggtggctggctatgttctcattgccctgaacaccgtggagagaatccct
ttggagaacctgcagatcatcaggggaaatgctctctacgaaaacacctacgccttagcc
gtcctgtccaactatggaaccaacaaaactgggcttagggaactgcccatgcggaactta
caggaaattctgatcggtgctgtgcgatttagcaacaaccccatcctctgcaatatggag
accatccagtggagggacatcgtccaagatgtctttctgagcaacatgtcaatggacgta
cagcgccacctgacgggctgcccgaaatgtgatccgagctgtcccaatggaagctgctgg
ggaagaggagaggagaactgccagaaattgaccaaaatcatctgcgcccagcaatgttcc
cggcgttgtcgtggcaggtcccctagcgactgctgccacaaccagtgtgccgcagggtgt
acagggcccagagagagtgactgtctggtctgccacaggttccgagatgaagccacgtgc
aaagacacctgcccaccactcatgctgtacaaccccaccacgtaccagatggatgtcaac
cctgaggggaagtacagctttggtgccacctgtgtgaagaaatgccccagaaactacgtg
gtgacagatcacggctcgtgtgtccgggcctgtgggccagactactatgaagtagaagaa
gatggagtcagcaagtgtaaaaaatgtgacgggccctgccgcaaagtttgcaatggcata
ggcattggtgaatttaaagacacactctccataaatgctacaaacatcaaacacttcaag
tactgcactgccatcagtggggacctccacatcctgccagtggcctttaagggggattct
ttcacccgcactcctcctctagacccacgggaactagaaattctcaaaactgtgaaggaa
ataacagggtttttgctgattcaggcttggcctgaaaactggactgacctccatgctttt
gagaacctagaaataattcgtggcagaacaaagcaacatggtcagttttctctggcggtt
gtcggcctgaacataacatcgctggggttgcgttccctcaaggagatcagtgatggggat
gtgattatttctgggaaccgaaatttgtgctacgcaaacactataaactggaaaaaactc
ttcgggacgcccaatcaaaagaccaaaatcatgaacaacagagctgaaaaggactgcaag
gccacgaaccacgtctgtaatcctttatgctcctcggaaggctgctggggccctgagccc
acggactgtgtctcctgccagaatgtgagcagaggcagggagtgcgtggacaagtgcaac
atcctggagggggaaccgagggagtttgtggaaaattctgaatgcatccagtgccatcca
gaatgtctgccccagaccatgaacatcacctgtacaggccgggggccagacaactgcatc
aagtgtgcccactatgttgatggtccccactgtgtcaagacctgcccttcgggcatcatg
ggggagaacaacaccctggtctggaagtttgcagatgccaataacgtctgccacctctgc
catgcaaactgtacctatggatgtgctgggccaggccttaaaggatgtcaacaaccagaa
gggccaaagatcccatccatcgccactgggattgtgggtggcctcctcttcatagtagtg
gtggcccttgggatcggcctcttcatgcgtcgacgtcagcttgtccgaaaacgtacacta
cgccgcctgcttcaagagagagagctcgtggaacctctcacacccagcggagaagctccg
aaccaagcccacttgaggatattaaaggaaacagaattcaaaaagatcaaagttctgggt
tcaggagcatttggcacagtgtataagggtctctggatcccagaaggcgagaaagtgaaa
atccctgtggccatcaaggagttaagagaagccacatctcccaaagccaacaaggaaatc
cttgatgaagcctacgtgatggccagtgtggacaaccctcatgtatgccgcctcctgggc
atctgtctgacctccactgtccagctcattacacaactcatgccctatggttgcctcctg
gactatgtccgagaacataaggacaacattggctcccagtacctactcaactggtgtgtg
cagattgcaaagggcatgaactacctggaagaccggcgtttggtacaccgtgacttggca
gccaggaatgtactggtaaagacaccacagcatgtcaagatcacagattttggactggcc
aaactgcttggtgctgaggagaaagaataccatgcagaggggggcaaagtgcctatcaag
tggatggctttggaatcaattttacaccgaatttatacacaccaaagcgacgtctggagc
tatggagtcaccgtgtgggaactgatgacctttgggtccaagccttatgatgggatccct
gcaagtgagatctcatccatcctagagaaaggagagcgccttccacagccacctatctgc
accatcgacgtctacatgatcatggtcaagtgctggatgatagatgctgatagccgccca
aagttccgagagttgattctcgaattctccaaaatggccagagacccacagcgctacctt
gttatccagggggatgaaaggatgcatttgccgagccctacagactccaacttttaccga
gccctgatggaggaggaggacatggaagacgtagttgatgctgatgaatacctcatccca
cagcaaggcttcttcaacagcccatccacgtcacggactccactcttgagctctctgagt
gcaaatagcaacagttccactgtggcttgcattaatagaaatgggagctgccgtgtcaaa
gaagacgccttcttgcaacggtatagctccgatcccaccagcgtcctgacagaggacaac
atagatgacacattccttcccgtgcctgaatatataaaccaatctgttcccaagaggccg
gctggctctgtgcagaacccagtctatcacaatcagcccctgcatccagctcctggaaga
gacctgcattatcaaaatccccatagcaatgcggtgagcaaccctgagtatctcaacact
gcccagccgacctgcctcagtagtgggtttgacagctctgccctctggatccagaaaggc
agccaccaaatgagcctggacaaccctgactaccagcaggacttctttcccaaagaagcc
aagccgaatggcatctttaagggccccacagctgaaaatgcagagtacctgcgggtggca
ccgccaagcagtgagtttagtggagcatga

KEGG   Rattus norvegicus (rat): 24553
Entry
24553             CDS       T01003                                 

Gene name
Met
Definition
(RefSeq) hepatocyte growth factor receptor precursor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04520  Adherens junction
rno05100  Bacterial invasion of epithelial cells
rno05144  Malaria
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05211  Renal cell carcinoma
rno05218  Melanoma
rno05223  Non-small cell lung cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24553 (Met)
   04014 Ras signaling pathway
    24553 (Met)
   04015 Rap1 signaling pathway
    24553 (Met)
   04020 Calcium signaling pathway
    24553 (Met)
   04151 PI3K-Akt signaling pathway
    24553 (Met)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24553 (Met)
   04520 Adherens junction
    24553 (Met)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    24553 (Met)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24553 (Met)
   05202 Transcriptional misregulation in cancer
    24553 (Met)
   05206 MicroRNAs in cancer
    24553 (Met)
   05205 Proteoglycans in cancer
    24553 (Met)
   05230 Central carbon metabolism in cancer
    24553 (Met)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24553 (Met)
   05226 Gastric cancer
    24553 (Met)
   05218 Melanoma
    24553 (Met)
   05211 Renal cell carcinoma
    24553 (Met)
   05223 Non-small cell lung cancer
    24553 (Met)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    24553 (Met)
  09174 Infectious disease: parasitic
   05144 Malaria
    24553 (Met)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24553 (Met)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24553 (Met)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     24553 (Met)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  MET family
   24553 (Met)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema TIG Pkinase PSI Kinase-like Pkinase_fungal PepSY_TM
Other DBs
NCBI-GeneID: 24553
NCBI-ProteinID: NP_113705
RGD: 3082
Ensembl: ENSRNOG00000052745
UniProt: P97523
Position
4
AA seq 1382 aa
MKAPTALAPGILLLLLTLAQRSHGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHGH
HIYLGATNYIYVLNDKDLQKVSEFKTGPVVEHPDCFPCQDCSSKANVSGGVWKDNVNMAL
LVDTYYDDQLISCGSVNRGTCQRHVLPPDNAADIQSEVHCMFSPLAEEESGQCPDCVVSA
LGAKVLLSEKDRFINFFVGNTINSSYPPDYSLHSISVRRLKETQDGFKFLTDQSYIDVLG
EFRDSYPIKYIHAFESNHFIYFLTVQKETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECI
LTEKRRKRSTREEVFNILQAAYVSKPGANLAKQIGASPYDDILYGVFAQSKPDSAEPMNR
SAVCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEVRSDEYRTE
FTTALQAVDLFMGRLNHVLLTSISTFIKGDLTIANLGTSEGRFMQVVLSRTAHFTPHVNF
LLDSHPVSPEVIVEHPSNQNGYTLVVTGKKITKIPLNGLGCGHFQSCSQCLSAPYFIQCG
WCHNRCVHSNECPSGTWTQEICLPAVYKVFPTSAPLEGGTMLTICGWDFGFKKNNKFDLR
KTKVLLGNESCTLTLSESTTNTLKCTVGPAMSEHFNVSVIVSNSRETTQYSAFSYVDPVI
TSISPRYGPHAGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSDSILECYTPGHTVSAE
FPVKLKIDLADRVTSSFSYGEDPFVSEIHPTKSFISGGSTITGIGKNLNSVSTPKLVIEV
HDVGVNYTVACQHRSSSEIICCTTPSLQQLDLQLPLKTKAFFLLDGILSKHFDLTYVHDP
MFKPFEKPVMISMGNENVVEIKGDDIDPEAVKGEVLKVGNKSCENLHWHSEALLCTVPSD
LLKLNGGELNIEWKQAVSSTVLGKVIVQPDQNFAGLIIGAVSISVVVLLVSGLFLWLRKR
KHKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNG
ACRQVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVH
FNEVIGRGHFGCVYHGTLLDSDGKKIHCAVKSLNRITDIEEVSQFLTEGIIMKDFSHPNV
LSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKK
FVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQK
FTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITIYLLQGRRLLQPEYCPDALYEVMLKC
WHPKAEMRPSFSELVSRISSIFSTFIGEHYVHVNATYVNVKCVAPYPSLLPSQDNIDGEA
NT
NT seq 4149 nt   +upstreamnt  +downstreamnt
atgaaggctcccaccgcgctggcacctggcattctgctgctgctgctgaccttggcgcag
aggagccatggggagtgcaaggaggccctagtgaagtctgagatgaacgtgaacatgaag
taccagcttcccaacttcaccgcagaaacccccatccagaatgtcgtcctccatgggcac
catatttatctcggagccacaaactacatttatgttttaaatgacaaagaccttcagaag
gtatctgagttcaagaccgggcccgtggtggaacacccagattgttttccttgtcaggac
tgcagcagcaaagccaatgtgtcaggaggtgtttggaaagacaacgtcaacatggcgctg
cttgttgacacttactatgacgaccagctcatcagctgtggcagcgtcaacagagggacc
tgccaaaggcatgtccttcctcctgacaatgctgccgacattcagtccgaggttcactgc
atgttctccccacttgcggaggaagagtcaggccagtgtcccgactgtgtagtgagtgcc
ctgggagccaaagtcctcctgtctgaaaaggaccggttcatcaatttcttcgtggggaat
acgataaactcttcctaccctcccgattattcattgcattcaatatcggtgaggcggctg
aaggaaacccaggacggttttaagtttttgacagaccagtcctacattgatgtcctggga
gaattccgagattcctaccccatcaagtacatacatgccttcgaaagcaaccattttatc
tactttctgactgtccagaaggaaaccctagatgctcagactttccatacaagaataatc
aggttctgttctgtagactctgggttgcactcctacatggaaatgcctctggagtgcatt
ctgacggaaaaaagaagaaagagatccacaagggaagaagtgtttaatatcctccaagcc
gcgtatgtcagtaaaccaggggccaatcttgctaagcaaataggggccagcccgtatgat
gacattctctacggggtgtttgcacaaagcaagccagattctgctgagcccatgaaccga
tcagcggtctgtgcattccccatcaaatatgtcaatgacttcttcaacaagattgtcaac
aaaaacaacgtacggtgtctccagcatttttatggacccaaccacgagcactgtttcaat
aggaccctgctgagaaattcatcgggctgcgaagtgcgcagtgacgagtaccggacggag
tttaccacagcgctgcaggctgtggatttattcatgggccggctcaaccatgtactcttg
acgtctatctctaccttcatcaaaggtgacctcaccattgctaatctagggacatcagaa
ggtcgcttcatgcaggtggtgctctctcgcacagcacatttcaccccccatgtgaatttc
ctcctggattcccatcctgtgtctccggaagttattgtcgaacatccatcaaatcaaaat
ggctataccctggtggtcacagggaagaagatcaccaagattccactgaatggcctaggc
tgtgggcatttccagtcctgcagtcagtgtctctctgccccctactttatacagtgtggc
tggtgccacaatcggtgtgtgcattccaatgaatgccccagcggtacatggactcaagag
atctgtctgccagcagtttataaggttttccccactagtgcacccctcgaaggaggaaca
atgctgaccatatgtggctgggactttggattcaagaagaataataaatttgatttaagg
aaaaccaaagttctgcttggcaacgagagctgtaccttgaccttaagcgagagcacgaca
aatacgttgaaatgcacagttggccccgcgatgagtgagcacttcaatgtgtctgtgatc
gtctcaaacagtcgagagacaacacagtacagtgcgttttcctatgtggatcctgtaata
acaagtatttctccaaggtatggtcctcatgccggaggcaccttactcactttgactgga
aaatacctcaacagcggcaattctagacacatttcaatcggagggaaaacatgtacttta
aaaagtgtatcagatagcattctcgaatgctacaccccaggccacaccgtctctgccgag
tttcccgtgaaattgaaaatcgacctggctgaccgagtgacaagcagcttcagttacggg
gaagacccgtttgtctctgaaatccacccgaccaaatcttttatcagtggtggaagcaca
ataacggggattggaaagaacctgaattcagttagcaccccaaagctggtaatagaagtg
catgacgtgggcgtgaactacaccgtggcgtgccaacatcgctcgagttcagagatcatc
tgctgcaccactccttccctgcaacagctggacctgcaactccccctgaagaccaaagcc
ttcttcctgctggacgggatcctttccaaacactttgatctcacttatgtacatgatcct
atgtttaagccttttgaaaagccagtaatgatctccatgggcaatgagaatgtagtggaa
attaagggagacgatattgaccctgaagcagttaaaggtgaagtgttaaaagtcgggaat
aagagctgtgagaatctccactggcattctgaagctttgttgtgtacggtccccagtgac
ctgctgaagctgaacggcggcgagctaaatatagagtggaagcaagcagtctcttcaact
gtccttggaaaagtgatcgttcaaccggatcagaattttgcaggattgatcattggtgcg
gtctcaatatcagtggtagttttgttagtatccgggctcttcctgtggctgagaaagaga
aagcataaagatctgggcagtgaattagttcgctatgacgcaagagtacacactcctcat
ttggataggcttgtaagtgcccgaagtgtaagcccaactacagagatggtctcaaatgag
tctgtagactacagagctacttttccagaagaccagtttcccaactcctctcagaatgga
gcctgcagacaagtgcagtatccactgacagatctgtcccccatcctgacgagtggagac
tctgatatatccagcccattactacaaaacactgttcacattgacctcagcgctctaaat
ccagagctggtccaagcggtgcagcacgtagtgattggacccagtagcctgattgtgcat
ttcaatgaagtcataggaagagggcattttggctgtgtctatcatgggactttgttggac
agtgacggaaagaaaattcactgtgctgtgaaatccttgaatagaatcacagatatagaa
gaagtctcccagtttctgactgagggaatcatcatgaaagatttcagccaccccaatgtt
ctctcactcttgggaatctgcctgcggagtgaagggtcccctctggtggttctgccctat
atgaagcacggagatcttcgcaatttcattcgaaacgagactcataacccaactgtgaaa
gatcttataggattcggtcttcaagtagccaagggcatgaaatatcttgccagcaaaaag
tttgtccacagagacttagctgcaagaaactgcatgttggatgaaaaattcactgtcaag
gttgctgatttcggtcttgccagagacatgtacgacaaagagtattatagcgtccacaac
aaaacgggtgcgaaactaccggtgaagtggatggctttagagagtctgcagacgcaaaag
ttcaccaccaagtcagacgtgtggtccttcggtgtgcttctctgggagctcatgacgaga
ggagcccctccttatcctgacgtgaacacatttgatatcactatatacctgttgcaaggc
agaagactcttgcaaccagagtactgtccagacgccttgtatgaagtgatgctaaaatgc
tggcaccccaaagcagaaatgcgcccatcgttttctgaactggtctccagaatatcctca
atcttctccactttcattggcgagcactatgtccatgtgaacgctacttatgtgaatgta
aaatgtgttgctccatatccttctctgttgccatcccaagacaacattgacggcgaagcg
aacacatga

KEGG   Rattus norvegicus (rat): 24596
Entry
24596             CDS       T01003                                 

Gene name
Ngfr
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 16 precursor
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04215  Apoptosis - multiple species
rno04722  Neurotrophin signaling pathway
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24596 (Ngfr)
   04014 Ras signaling pathway
    24596 (Ngfr)
   04015 Rap1 signaling pathway
    24596 (Ngfr)
   04151 PI3K-Akt signaling pathway
    24596 (Ngfr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24596 (Ngfr)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    24596 (Ngfr)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    24596 (Ngfr)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    24596 (Ngfr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    24596 (Ngfr)
   04090 CD molecules [BR:rno04090]
    24596 (Ngfr)
Cytokine receptors [BR:rno04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   24596 (Ngfr)
CD molecules [BR:rno04090]
 Proteins
  24596 (Ngfr)
SSDB
Motif
Pfam: TNFR_16_TM TNFR_c6 Death TPR_21
Other DBs
NCBI-GeneID: 24596
NCBI-ProteinID: NP_036742
RGD: 3177
Ensembl: ENSRNOG00000005392
UniProt: P07174 G3V6P1
Structure
PDB: 

Position
10
AA seq 425 aa
MRRAGAACSAMDRLRLLLLLILGMSSGGAKETCSTGLYTHSGECCKACNLGEGVAQPCGA
NQTVCEPCLDSVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCAYGYYQDEET
GHCEACSVCEVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRE
CTPWADAECEEIPGRWIPRSTPPEGSDSTAPSTQEPEVPPEQDLVPSTVADMVTTVMGSS
QPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGE
KLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHL
AGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSEST
ATSPV
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgaggagggcaggtgctgcctgcagcgccatggaccggctgcgcctgctgctgctgctg
attctagggatgtcctctggaggtgccaaggagacatgttccacaggcctgtacacccac
agcggagagtgctgcaaagcctgcaacttgggcgaaggcgtggcccagccctgcggagcc
aaccagaccgtgtgtgaaccctgcctggacagtgttacattctccgatgtggtgagcgcc
actgagccgtgcaagccgtgcaccgagtgcctgggcctgcagagcatgtccgctccctgt
gtggaggcagacgatgcagtgtgcagatgtgcctatggctactaccaggacgaggagact
ggccactgtgaggcttgcagcgtgtgcgaggtgggctcgggactcgtgttctcctgccag
gacaaacagaacacagtgtgtgaagagtgcccagagggcacatactcagacgaagccaac
cacgtggacccgtgcctaccctgcacggtgtgcgaggacactgagcgccagttacgcgag
tgcacgccctgggctgatgctgaatgcgaagagatccctggtcgatggatcccaaggtct
acgcccccggagggctccgacagcacagcgcccagcacccaggagcctgaggttcctcca
gagcaagaccttgtacccagtacagtggcggatatggtgaccactgtgatgggcagctcc
cagcctgtagtgacccgcggcaccaccgacaacctcattcctgtctattgctccatcttg
gctgctgtggtcgtgggccttgtggcctatattgctttcaagaggtggaacagctgcaaa
caaaataaacaaggcgccaacagccgccccgtgaaccagacgcccccaccggagggagag
aaactgcacagcgacagtggcatctctgtggacagccagagcctgcacgaccagcagacc
catacgcagactgcctcaggccaggccctcaagggtgatggcaacctctacagtagcctg
cccctgaccaagcgtgaggaggtagagaaactgctcaacggggatacctggcgacatctg
gcaggcgagctgggttaccagcctgaacatatagactcctttacccacgaggcctgccca
gtgcgagccctgctggccagctggggtgcccaggacagtgcaacgcttgatgccctttta
gccgccctgcgacgcatccagagagctgacattgtggagagtctatgcagcgagtccact
gccacgtccccagtgtga

KEGG   Rattus norvegicus (rat): 24629
Entry
24629             CDS       T01003                                 

Gene name
Pdgfrb
Definition
(RefSeq) platelet-derived growth factor receptor beta precursor
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04540  Gap junction
rno04630  JAK-STAT signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24629 (Pdgfrb)
   04014 Ras signaling pathway
    24629 (Pdgfrb)
   04015 Rap1 signaling pathway
    24629 (Pdgfrb)
   04630 JAK-STAT signaling pathway
    24629 (Pdgfrb)
   04020 Calcium signaling pathway
    24629 (Pdgfrb)
   04072 Phospholipase D signaling pathway
    24629 (Pdgfrb)
   04151 PI3K-Akt signaling pathway
    24629 (Pdgfrb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24629 (Pdgfrb)
   04540 Gap junction
    24629 (Pdgfrb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24629 (Pdgfrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24629 (Pdgfrb)
   05206 MicroRNAs in cancer
    24629 (Pdgfrb)
   05230 Central carbon metabolism in cancer
    24629 (Pdgfrb)
   05231 Choline metabolism in cancer
    24629 (Pdgfrb)
  09162 Cancer: specific types
   05214 Glioma
    24629 (Pdgfrb)
   05218 Melanoma
    24629 (Pdgfrb)
   05215 Prostate cancer
    24629 (Pdgfrb)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    24629 (Pdgfrb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24629 (Pdgfrb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24629 (Pdgfrb)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    24629 (Pdgfrb)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     24629 (Pdgfrb)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   24629 (Pdgfrb)
CD molecules [BR:rno04090]
 Proteins
  24629 (Pdgfrb)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 V-set C2-set_2 TCAD9
Other DBs
NCBI-GeneID: 24629
NCBI-ProteinID: NP_113713
RGD: 3285
Ensembl: ENSRNOG00000018461
UniProt: Q05030
Position
18
AA seq 1097 aa
MGLPEVMPASVLRGQLLLFVLLLLGPQISQGLVITPPGPEFVLNISSTFVLTCSSSAPVM
WEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVP
DPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFIG
TFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGND
VVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHG
DEKAINVTVIENGYVRLLETLEDVQIAELHRSRTLQVVFEAYPTPSVLWFKDNRTLGDSS
AGELVLSTRNVSETRYVSELTLVRVKVSEAGYYTMRAFHADDQVQLSFKLQVNVPVRVLE
LSESHPANGEQILRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVT
FWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGRDSQEVTVVPHSLPFKVVVISAILAL
VVLTVISLIILIMLWQRKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDSTWELPRDQLV
LGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPH
LNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSNKHCPPSTELYSNALP
VGLSLPSHLNLTGESDGGYMDMSKDESVDYVPMLDMKGHIKYADIESSSYMAPYDNYVPS
APERTYRATLINDSPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVK
ICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGG
TPYPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVLLLERL
LGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGLHSLRSPLDTSSVLYTAVQPNETDNDY
IIPLPDPKPDAADEGLLEGSPSLASSTLNEVNTSSTISCDSPLELQEEPQAEPEAQLEQP
QDSGCPGPLAEAEDSFL
NT seq 3294 nt   +upstreamnt  +downstreamnt
atggggcttccagaggtgatgccagcttcagtcctcagaggccaattgttgctgttcgtg
ctattgctcctgggaccacagatctcccaaggcctagtcatcacgccccctgggccagag
ttcgtcctcaacatttcgagcacctttgttctgacatgctcaagttcagctccagtgatg
tgggaacagatgtcccaggtgccctggcaagaagcagccatgaaccaggatggcaccttc
tccagtgtgctgacactgactaatgtcactgggggagacaccggagaatacttttgtgtc
tacaacaactcactggggccagagctcagtgagcggaagcgcatctatatctttgtgcca
gatcccaccatgggcttcctcccgatggactctgaggacctattcatttttgtcacggat
gtcactgagacgacgattccatgccgagtgacagacccccagctggaggtgacgctgcat
gagaagaaagtggatatccccctacatgtaccctatgaccaccagcgaggtttcattggt
acttttgaggacaagacttacatttgcaaaaccaccattggggacagggaagtggactcc
gatacttactatgtctacagcctgcaggtgtcatccatcaatgtctctgtgaatgcagtg
cagactgtggtccgccagggcgagagcatcaccatcaggtgcatcgtgatgggcaatgat
gtggtcaacttccagtggacgtacccccgcatgaagagtgggcggctggtggagccggtg
acagattacctcttcggagtgccctcccgcattggctccattcttcatatccccaccgct
gagctgagtgactctggcacctatacttgcaacgtgtcagtgagtgtgaatgaccacggc
gatgagaaagccatcaacgttactgtgatcgaaaatggctatgtgcggctgctggaaaca
ctggaagacgtacaaattgctgagctgcaccggagccggacgttgcaggtggtgtttgag
gcttatccgacgccctctgtcctgtggttcaaggacaaccgtaccttgggtgactccagc
gctggcgagttggttctgtccactcgcaacgtgtctgagacccggtatgtgtcagaactg
accttggtacgtgtgaaggtgtcagaagcgggctactataccatgcgggccttccatgcg
gacgaccaggtccagctctcattcaagctgcaggtcaatgtccctgtccgtgtactggag
ctgagtgagagtcatcctgccaatggggagcagatactccgctgtcggggccggggcatg
cctcagccaaatgtcacctggtctacctgcagagacctcaaaaggtgtccgcgaaaactg
tcacccacacccttggggaatagttccaaggaggagagccagctagaaacgaacgtgact
ttctgggaggaagatcaggaatatgaggtggtgagcacgctgcgcctgcgtcacgtggac
cagccactgtcagtgcgctgtatgctgcagaactcgatgggcagagattcacaagaggtc
accgtggtaccacactccttgcctttcaaagtggtggtgatctcagccatcttggccttg
gtggtccttactgtcatctctctcatcatcctcatcatgctgtggcagaggaaaccacgc
tatgagatccgatggaaggtcattgagtctgtgagctctgacggccatgagtacatctat
gtggatcctgtgcagttgccttacgactccacctgggagctgccacgggaccagcttgtt
ctgggacgcactcttggctctggggctttcggacaggtggtggaggccaccgctcatggt
ctgagccactcacaagccaccatgaaagtggctgtcaagatgctgaaatctacagccaga
agcagtgagaagcaagccctcatgtcggagttgaagatcatgagtcatctcggaccccac
ctgaacgtggtcaacctgctgggggcctgtaccaaaggagggcccatctacattatcacg
gaatactgccgttatggtgacctggtggactacctgcaccgaaacaaacacaccttcctg
caacgacactccaacaagcattgtccacccagcactgagctctacagcaacgccctgccg
gtggggctctccctacccagccacttgaacctgactggggagagcgacggtggttacatg
gacatgagcaaggatgaatctgtagattacgtgcccatgttggacatgaaaggacacatc
aaatacgcggacatcgagtcctccagctacatggccccttacgataactatgtcccatct
gcccctgaaaggacctatcgtgctaccttaatcaacgactcaccagtgctcagctacaca
gacctcgtgggcttcagttaccaagtggccaatggcatggaattcttggcctctaagaac
tgtgttcaccgagacctggcggccaggaatgtgctcatctgtgagggcaagttggtcaag
atctgtgactttggcctggctcgagacatcatgcgggactcaaactacatctccaaaggc
agtactttcctgcctctgaagtggatggccccagagagcatcttcaacagcctctacacc
accttgagtgatgtgtggtcctttggaatcctactctgggaaatcttcacactgggtggc
accccttacccagagctgcccatgaacgaccagttctacaatgccatcaagaggggctac
cgcatggcccaacctgctcatgcctccgacgagatctatgagatcatgcagaaatgctgg
gaagaaaagtttgagactcggccccccttctctcagctggtgctgctcctggagaggctt
ctgggtgaaggctataaaaagaagtaccagcaggtggatgaggagtttctgaggagtgac
catccagccatcctgaggtcccaagcccgcttgccgggtctccacagcctccgatcccct
ctggataccagctctgtcctctacactgctgtgcagcctaatgagactgacaatgactac
atcatccccttgcctgaccccaagcctgatgctgctgatgagggcctcctagagggttcc
cccagccttgccagctccaccttgaatgaagtcaacacttcttccaccatctcctgcgac
agccccctggagctccaagaagagccgcaagcagagcctgaggcacagctggagcagcca
caggattcaggctgcccaggacctctggctgaggcagaggacagcttcctgtag

KEGG   Rattus norvegicus (rat): 24954
Entry
24954             CDS       T01003                                 

Gene name
Insr
Definition
(RefSeq) insulin receptor preproprotein
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04072  Phospholipase D signaling pathway
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04520  Adherens junction
rno04910  Insulin signaling pathway
rno04913  Ovarian steroidogenesis
rno04923  Regulation of lipolysis in adipocytes
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04960  Aldosterone-regulated sodium reabsorption
rno05010  Alzheimer disease
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24954 (Insr)
   04014 Ras signaling pathway
    24954 (Insr)
   04015 Rap1 signaling pathway
    24954 (Insr)
   04066 HIF-1 signaling pathway
    24954 (Insr)
   04068 FoxO signaling pathway
    24954 (Insr)
   04072 Phospholipase D signaling pathway
    24954 (Insr)
   04022 cGMP-PKG signaling pathway
    24954 (Insr)
   04151 PI3K-Akt signaling pathway
    24954 (Insr)
   04152 AMPK signaling pathway
    24954 (Insr)
   04150 mTOR signaling pathway
    24954 (Insr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    24954 (Insr)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    24954 (Insr)
   04923 Regulation of lipolysis in adipocytes
    24954 (Insr)
   04913 Ovarian steroidogenesis
    24954 (Insr)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24954 (Insr)
  09149 Aging
   04211 Longevity regulating pathway
    24954 (Insr)
   04213 Longevity regulating pathway - multiple species
    24954 (Insr)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24954 (Insr)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    24954 (Insr)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    24954 (Insr)
   04932 Non-alcoholic fatty liver disease
    24954 (Insr)
   04931 Insulin resistance
    24954 (Insr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24954 (Insr)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    24954 (Insr)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     24954 (Insr)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   24954 (Insr)
CD molecules [BR:rno04090]
 Proteins
  24954 (Insr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like Insulin_TMD fn3 Kinase-like DUF4476
Other DBs
NCBI-GeneID: 24954
NCBI-ProteinID: NP_058767
RGD: 2917
Ensembl: ENSRNOG00000029986
Vega: OTTRNOG00000001719
UniProt: T2CB11
Structure
PDB: 
4XST

Position
12
AA seq 1384 aa
MGSGRGCETTAVPLLMAVAALLVGTAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDVCPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHKECL
GNCSEPDDPTKCVACRNFYLDGQCVETCPPPYYHFQDWRCVNFSFCQDLHYKCRNSRKPG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCQILEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGFLKIRRSYALVSLSFFRKLHLIRGETL
EIGNYSFYALDNQNLRQLWDWNKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPQRSNDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVT
FSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVY
WERQAEDSELFELDYCLKGLKLPSRTWSPPFESDDSQKHNQSEYDDSASECCSCPKTDSQ
ILKELEESSFRKTFEDYLHNVVFVPRKTSSGNGAEDTRPSRKRRSLEEVGNVTATTPTLP
DFPNISSTIAPTSHEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPEERCSVAA
YVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHL
CVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKII
IGPLIFVFLFSVVIGSIYLFLRKRQPDGPMGPLYASSNPEYLSASDVFPSSVYVPDEWEV
PREKITLLRELGQGSFGMVYEGNAKDIIKGEVETRVAVKTVNESASLRERIEFLNEASVM
KGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSHLRSLRPDAENNPGRPPPTLQEMIQ
MTAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLL
PVRWMSPESLKDGVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDPP
DNCPERLTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFYSEENKAPESEELE
MEFEDMENVPLDRSSHCQREEAGCREGGSSLSIKRTYDEHIPYTHMNGGKKNGRVLTLPR
SNPS
NT seq 4155 nt   +upstreamnt  +downstreamnt
atgggctccgggagaggatgtgagacgacggcggtgccgttgctgatggccgtggccgcg
ttgctggtgggcacagccggccacctgtaccctggagaggtgtgcccgggaatggacatc
cggaacaacctgaccaggttgcatgagctggagaactgctcggtcattgagggccatctg
cagatcctcttgatgttcaagaccagacccgaagatttccgagacctcagtttccccaaa
ctcatcatgatcacagactacctgcttcttttccgtgtctatggcctagaaagtctaaaa
gacctcttcccaaacctcacagtcatccgaggctcccgtctcttcttcaactatgccctg
gtcatcttcgagatggtccacctgaaggagctgggtctttacaacctcatgaacatcacc
cggggctctgtccgcatcgagaagaataatgaactctgctacctggccactatcgactgg
tcccgcatcctggattccgtggaggacaactacattgtactgaacaaagatgacaatgag
gaatgtggggacgtctgtccaggcacagccaagggcaagaccaactgccctgccaccgtc
atcaatgggcagtttgtggaacggtgctggacacacagtcattgtcagaaagtttgccca
accatctgtaagtcacatggctgcacagctgaaggcctgtgctgtcacaaggagtgcctg
ggcaactgttcagaacccgatgaccctaccaagtgtgtggcctgtcgaaacttctacctg
gatggtcagtgtgtggagacctgcccaccaccctactatcacttccaggattggcgctgt
gtaaacttcagcttctgccaagaccttcactacaaatgcaggaactctcggaagcctggc
tgtcaccaatacgtcattcacaacaacaagtgcatccccgagtgcccgtctggctatacc
atgaattccagcaacttgatgtgcaccccgtgtctgggaccctgtcctaaggtctgccaa
atcctcgaaggcgagaagaccattgattccgtgacatctgcccaggagctccgaggctgc
actgtgatcaatggcagcctgattatcaacatccgagggggcaacaacctggcagctgaa
ctagaggctaaccttggcctcattgaagaaatctcagggttcctaaagatccgtcgctcc
tatgctctggtgtcactttctttcttcaggaagctacatctgattcgaggagagaccttg
gaaattgggaactattctttctacgccttggacaaccagaacctgaggcagctgtgggac
tggaacaagcacaacctcacgatcactcagggcaagctcttcttccactacaaccccaaa
ctctgcctgtctgagatccacaagatggaggaagtgtccggaaccaagggccgccaggag
aggaacgacattgccctgaagaccaacggggaccaggcatcctgtgaaaatgaattactt
aaattctctttcatccggacgtcttttgacaagatcttgctgaggtgggagccctactgg
ccccccgacttccgagatctcctgggattcatgctgttctacaaagaggccccttatcag
aacgtgacagagtttgacgggcaggatgcgtgtggctccaacagctggactgtggtggat
attgacccgccccagaggtccaacgaccctaagtctcagaccccaagccaccctgggtgg
ctgatgcggggcctcaaaccctggacccagtatgccatctttgtcaagaccttggttacc
ttctctgatgaacgccggacctatggagccaaaagtgatatcatctatgtgcaaacagat
gccaccaatccttccgttcccctggatcccatatcagtttccaactcctcatctcagatt
atcttaaagtggaagcccccctcggaccccaatggcaacatcacacactacctggtctac
tgggagaggcaggcggaggacagcgagctgttcgagttggattattgtctcaaagggctg
aagctcccctcacgcacctggtccccaccttttgagtctgacgattctcaaaagcacaat
cagagtgagtatgacgactcggccagcgagtgctgctcatgtcctaagactgactctcag
atcctgaaggagctggaggagtcttcattcaggaagaccttcgaggattacctgcacaac
gtggtttttgttcccagaaaaacctcttcaggcaatggtgctgaggacactaggccatcc
cgaaagcgaagatcccttgaagaggtgggcaatgtgacagccactacacccacacttcca
gattttcccaacatctcctccaccatcgcgcccacaagccacgaagagcacagaccattt
gagaaagtagtaaacaaggagtcacttgtcatctctggcctgagacacttcactgggtac
cgcattgagctgcaggcatgcaatcaggactccccagaagagaggtgcagcgtggctgcc
tacgtcagtgcccggaccatgcctgaagctaaggcagatgacatcgttggccctgtgacc
catgaaatctttgagaacaatgttgtacacttaatgtggcaagagccaaaggaacctaat
ggtctgattgtgctatatgaagtgagctatcggcgatatggtgatgaggagctgcacctc
tgtgtctcccggaagcattttgccctggagcggggctgcaggcttcgagggctctctcca
ggaaactacagtgttcgagtccgggctacctctctggcaggaaatggctcctggacagaa
cccacctatttttatgtgactgattatttagatgtcccatcaaatattgccaaaattatc
atcgggcccctcatcttcgtcttcctcttcagtgtcgtgatcggaagtatttatctattc
ttgaggaagaggcagccagatgggccaatgggaccactgtacgcttcttcaaacccagag
tacctcagtgccagtgatgtctttccatcttccgtatacgttccggatgagtgggaggta
cctcgagagaagatcaccctcctccgagagctggggcagggatccttcggtatggtgtac
gaaggcaatgccaaggatatcatcaagggtgaggtagagacccgtgttgcggtgaagacg
gtcaatgagtcagccagtcttcgagaacggatcgagttcctcaatgaggcatcagtcatg
aagggcttcacctgtcatcacgtggtccgccttcttggggtggtgtccaaaggccagccc
acattggtagtgatggaactgatggctcatggagacctgaaaagtcacctccgttctctg
cggcccgatgctgagaacaacccaggccgtcctccccctaccttgcaagaaatgattcag
atgacagcagaaattgccgatggcatggcatacttgaacgccaagaagtttgtgcaccgg
gacctggcagctcggaactgcatggttgcccatgattttactgtcaaaatcggagacttt
ggaatgacgagagacatctacgagacagattactatcggaaagggggcaaggggttgctg
cccgtgaggtggatgtcacccgagtccctgaaggacggagtcttcactgcttcttccgac
atgtggtcctttggggtggtcctttgggaaatcaccagcctggctgagcaaccttaccaa
ggcctgtctaatgaacaggtgttgaaatttgtcatggatggaggctatctggatccccct
gataactgtccagagagactcactgacctgatgcgcatgtgctggcagttcaaccccaag
atgaggccgaccttcctggaaatcgtcaacctgctcaaggacgacctccaccccagcttt
ccggaagtttccttcttctacagcgaggagaacaaggctcccgagagtgaagagctggag
atggagttcgaggacatggagaatgtccccttggatcgttcctctcactgtcagagagaa
gaggctggatgccgggagggagggtcctctctgagcatcaaacggacctatgatgaacac
atcccctacacccacatgaacgggggcaagaagaatgggcgggtcctcaccctgccgagg
tcgaacccttcctaa

KEGG   Rattus norvegicus (rat): 25022
Entry
25022             CDS       T01003                                 

Gene name
Fgfr2
Definition
(RefSeq) fibroblast growth factor receptor 2 isoform b
  KO
K05093  fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04144  Endocytosis
rno04151  PI3K-Akt signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05215  Prostate cancer
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25022 (Fgfr2)
   04014 Ras signaling pathway
    25022 (Fgfr2)
   04015 Rap1 signaling pathway
    25022 (Fgfr2)
   04020 Calcium signaling pathway
    25022 (Fgfr2)
   04151 PI3K-Akt signaling pathway
    25022 (Fgfr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25022 (Fgfr2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25022 (Fgfr2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25022 (Fgfr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25022 (Fgfr2)
   05230 Central carbon metabolism in cancer
    25022 (Fgfr2)
  09162 Cancer: specific types
   05226 Gastric cancer
    25022 (Fgfr2)
   05215 Prostate cancer
    25022 (Fgfr2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    25022 (Fgfr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25022 (Fgfr2)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25022 (Fgfr2)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    25022 (Fgfr2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     25022 (Fgfr2)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   25022 (Fgfr2)
CD molecules [BR:rno04090]
 Proteins
  25022 (Fgfr2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   25022 (Fgfr2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set Ig_5 ABC1 Ig_4 C2-set_2 Kinase-like CBM9_1 FAM176 Pkinase_fungal
Other DBs
NCBI-GeneID: 25022
NCBI-ProteinID: NP_001103362
RGD: 2611
Ensembl: ENSRNOG00000016374
UniProt: F1LNW0 Q63240 Q63237 Q63236
Position
1
AA seq 840 aa
MGLPSTWRYGTGPGIGTVTMVSWGRFICLVLVTMATLSLARPSFSLVEDTTLEPEEPPTK
YQISQPEACVVAPGESLELRCMLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRD
SGLYACAAARTVDSETLYFMVNVTDAISSGDDEDDTDSSEDFVSENRSNQRAPYWTNTEK
MEKRLHAVPAANTVKFRCPAGGNPTPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESV
VPSDKGNYTCLVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVY
SDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYT
CLAGNSIGISFHSAWLTVLPAPVREKEITASPDYLEIAIYCIGVFLIACMVVTVIFCRMK
TTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLA
GVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDRPKEAVTVAVKMLKD
DATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRP
PGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMK
IADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGG
SPYPGIPVEELFKLLKEGHRMDKPTNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIL
TLTTNEEYLDLTQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYDPCLPQYPHINGSVKT
NT seq 2523 nt   +upstreamnt  +downstreamnt
atgggattaccgtccacatggagatatggaacaggaccagggattggcaccgtgaccatg
gtcagctgggggcgcttcatctgcctggtcttggtcaccatggcaaccttgtccctggcc
cggccctccttcagtttagttgaagataccactttagaaccagaagagccaccaaccaaa
taccaaatctcccaaccagaagcgtgcgtggttgcccccggggagtcgctagagttgcgc
tgcatgttgaaagatgccgccgtgatcagttggactaaggatggggtgcacttggggccc
aacaataggacagtgcttattggggagtacctccagataaaaggtgccacacctagagac
tccggcctctatgcttgtgctgcagctaggacggtagacagtgaaactttgtacttcatg
gtgaatgtcacagatgccatctcatctggagatgacgaggacgacacagatagctccgaa
gactttgtcagtgagaacaggagcaaccagagagcaccgtactggaccaacaccgaaaag
atggagaagcggctccatgctgtccctgccgccaacactgtgaagttccgctgtccagcc
ggggggaatccaacacccacaatgaggtggctaaaaaacgggaaggagtttaagcaggag
catcgcatcggaggctataaggtacgaaaccagcactggagccttattatggaaagtgtg
gtcccatcagacaaaggcaattacacctgcctggtggagaatgaatacgggtccatcaac
cacacctaccaccttgatgttgttgagcgatcaccacaccggcccatcctccaagctgga
ctgcctgcaaatgcctccacggtggtcggaggggacgtagaatttgtctgcaaggtttat
agtgatgcccagccccatatccagtggatcaaacatgtggaaaagaacggcagtaaatat
ggacctgatgggctgccctacctcaaggtcctgaaggccgccggtgttaacaccacggac
aaagaaattgaggttctctatattcggaatgtaacttttgaggatgctggggaatatacg
tgcttggcgggtaattctatcgggatatcctttcactctgcatggttgacagttctgcca
gcacctgtgagagagaaggagatcacagcttccccagattacctggagatagctatttac
tgcataggggtcttcttaatcgcctgcatggtggtgacagtcatcttttgccgaatgaag
accacgaccaagaagccagacttcagcagccagccagctgtgcacaagctgaccaagcgc
atccccctgcggagacaggtaacagtttcggccgagtccagctcgtccatgaactccaac
accccactggtgaggataacgacacgtctgtcctcaacggcggacaccccgatgctagca
ggggtctctgagtacgagttgccagaggatccaaagtgggaattccccagagataagctg
acgctgggcaaacccctgggggaaggctgcttcgggcaagtagtcatggctgaagcggtg
ggaatcgataaggacagacccaaggaggcagtcaccgtggcggtgaagatgttgaaagat
gacgccacagagaaggacctgtctgacctggtgtcagagatggagatgatgaagatgatt
ggtaaacataagaacatcatcaacctcctgggggcctgcacccaggatggacccctctat
gtcatagtcgaatacgcatcgaaaggcaacctccgggaatacctccgggcccggaggcca
cctggcatggagtactcctatgacattaaccgagttcccgaggagcagatgaccttcaag
gacttggtgtcctgcacctaccagctggcgagaggcatggagtacttggcttcccaaaaa
tgtatccatcgagacttggcagccagaaatgtgctggtaacagaaaacaacgtgatgaag
atagcagactttggcctggccagggatatcaacaacatagactattacaaaaagaccacg
aatgggcgacttccagtcaagtggatggctcctgaagccctttttgatagagtttacact
catcagagtgatgtctggtccttcggggtgttaatgtgggagatcttcactttagggggt
tcaccctacccagggattcccgtggaggaactttttaagctgctcaaagagggccacagg
atggacaagcccaccaactgcaccaatgaactgtacatgatgatgagggactgctggcat
gctgtaccctcacagaggcccacgtttaagcagttggtggaagacttggatcgaattctg
actctcacaaccaatgaggaatacttggacctcacccagcctctcgaacagtattctcct
agttaccccgacacaaggagctcttgttcttcaggggacgattctgtgttttctccagac
cccatgccttatgacccctgcctgcctcagtatccacacataaacggcagtgttaaaaca
tga

KEGG   Rattus norvegicus (rat): 25114
Entry
25114             CDS       T01003                                 

Gene name
Fgfr4
Definition
(RefSeq) fibroblast growth factor receptor 4 precursor
  KO
K05095  fibroblast growth factor receptor 4 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04144  Endocytosis
rno04151  PI3K-Akt signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25114 (Fgfr4)
   04014 Ras signaling pathway
    25114 (Fgfr4)
   04015 Rap1 signaling pathway
    25114 (Fgfr4)
   04020 Calcium signaling pathway
    25114 (Fgfr4)
   04151 PI3K-Akt signaling pathway
    25114 (Fgfr4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25114 (Fgfr4)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25114 (Fgfr4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25114 (Fgfr4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25114 (Fgfr4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25114 (Fgfr4)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25114 (Fgfr4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     25114 (Fgfr4)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   25114 (Fgfr4)
CD molecules [BR:rno04090]
 Proteins
  25114 (Fgfr4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set C2-set_2 TCAD9 Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 25114
NCBI-ProteinID: NP_001103374
RGD: 2612
Ensembl: ENSRNOG00000016763
UniProt: Q498D6
Position
17
AA seq 800 aa
MWLLLALLSIFQETPAFSLEASEEMEQEPCPAPISEQQEQVLTVALGQPVRLCCGRTERG
RHWYKEGSRLASAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMTVVHNLTLIMDDSLPS
INNEDPKTLSSSSSGHSYLQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPMPTIHW
LKNGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENSLGSIRYSYLLDVLER
SPHRPILQAGLPANTTAVVGSNVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFPYVQV
LKTTDINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPAEEEDLAWTTAT
SEARYTDIILYVSGSLALVLLLLLAGVYHRQAIHGHHSRQPVTVQKLSRFPLARQFSLES
RSSGKSSLSLVRGVRLSSSGPPLLTGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVV
RAEALGMDSSRPDQTSTVAVKMLKDNASDKDLADLISEMEMMKLIGRHKNIINLLGVCTQ
EGPLYVIVEYAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPALVSCAYQVARGMQY
LESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALF
DRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMERPPNCPSELYGLM
RECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPNNGDASSTCSSSDSVF
SHDPLPLEPSPFPFPEAQTT
NT seq 2403 nt   +upstreamnt  +downstreamnt
atgtggctgctgttggctttgttgagcatctttcaggagacaccagccttctcccttgag
gcctctgaggaaatggaacaggagccctgcccagccccaatctcggagcagcaagagcag
gtgttgactgtggcccttgggcagcctgtgcggctatgctgtggccgcactgagcgtggt
cgtcattggtacaaggagggcagccgtttagcatctgctgggagagtacggggctggaga
ggccgcctggagatcgccagcttccttcctgaggatgctggccggtacctctgcctggcc
cgtggctccatgactgtcgtacacaatcttactttgattatggatgactccttaccctcc
atcaataacgaggaccccaagaccctcagcagctcctcgagtgggcactcctacctgcag
caagcaccttactggacacacccccaacgcatggagaagaaactgcacgcggtacctgcc
gggaacactgtcaaattccgctgtccagctgcagggaaccccatgcccaccatccactgg
ctcaagaacggacaggccttccacggagagaatcgtatcggaggcattcggctgcgtcac
caacactggagcctcgtgatggagagcgtggtgccctcagaccgtggcacgtacacgtgt
cttgtggagaactctctgggtagcattcgctacagctatctgctggatgtgctggagcgg
tccccgcaccggcccatcctgcaggcgggactcccagccaacaccacggctgtggttggc
agcaacgtggagctgctgtgcaaggtgtacagtgacgcccagccgcacatccagtggctg
aagcacatcgttatcaacggcagcagtttcggcgctgatggtttcccctacgtacaagtc
ctgaagacaacagacatcaatagctcagaggtggaggtgctgtatctgaggaacgtgtcg
gctgaggatgcaggggagtacacctgcctggcgggcaactccatcggcctctcctaccag
tcagcgtggctcacagtgctacccgcagaggaagaagacctcgcgtggacaacagcaaca
tcggaggccagatatacagatattatcctatatgtatctggctcactggctttggttttg
ctcctgctgctggccggggtgtatcaccgacaagcaatccacggccaccactctcgacag
cctgtcactgtacagaagctgtcccggttccctttggcccggcagttctccttggagtcg
aggtcctctggcaagtcaagtttgtccctggtgcgaggtgtccggctctcctccagtggc
ccgcccttgctcacgggccttgtgagtctagacctacctctcgatccactttgggagttc
ccccgggacaggctggtgctcggaaagcccctgggtgagggctgctttgggcaagtggtt
cgtgcagaagcccttggcatggattcctcccggccagaccaaaccagcaccgtggctgtg
aagatgctgaaagacaatgcctccgacaaggatttggcagacctgatctctgagatggag
atgatgaagctaatcggaagacacaagaacatcattaacctgctgggtgtctgcactcag
gaagggcccctgtatgtgattgtggaatatgcggccaagggaaaccttcgggaattcctc
cgtgcccggcgtcccccaggccctgatctcagccctgatgggcctcggagcagcgaagga
ccgctctccttcccggccctggtctcctgtgcctaccaggtggcccgaggcatgcagtat
ctggagtctcggaagtgcatccaccgggacctggctgcccgaaacgtgctggtgaccgag
gatgacgtgatgaagatcgctgactttggtctggcccgtggtgtccaccacatcgactac
tataagaaaaccagcaatggccgcctgccagtcaagtggatggctcctgaggcgttgttt
gaccgtgtatacacacaccagagtgacgtgtggtccttcgggatcctgctgtgggaaatc
ttcaccctcgggggctccccataccccggcatcccagtggaggagctgttctcactgctg
cgagaggggcacaggatggagcggcccccaaactgcccctcagagctgtatgggctaatg
agggagtgttggcacgcagctccttctcagaggccgacttttaagcagctggtggaagct
ctggacaaggtcctgctggctgtctctgaagagtaccttgacctccgcctgacctttgga
ccctattcccccaacaatggggatgccagcagcacgtgctcctccagcgactcggttttc
agccacgaccctttgcccctcgagccaagccccttcccatttcctgaggcgcagaccaca
tga

KEGG   Rattus norvegicus (rat): 25267
Entry
25267             CDS       T01003                                 

Gene name
Pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha precursor
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04072  Phospholipase D signaling pathway
rno04144  Endocytosis
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04540  Gap junction
rno04630  JAK-STAT signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25267 (Pdgfra)
   04014 Ras signaling pathway
    25267 (Pdgfra)
   04015 Rap1 signaling pathway
    25267 (Pdgfra)
   04630 JAK-STAT signaling pathway
    25267 (Pdgfra)
   04020 Calcium signaling pathway
    25267 (Pdgfra)
   04072 Phospholipase D signaling pathway
    25267 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    25267 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25267 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25267 (Pdgfra)
   04540 Gap junction
    25267 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25267 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25267 (Pdgfra)
   05206 MicroRNAs in cancer
    25267 (Pdgfra)
   05230 Central carbon metabolism in cancer
    25267 (Pdgfra)
   05231 Choline metabolism in cancer
    25267 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    25267 (Pdgfra)
   05218 Melanoma
    25267 (Pdgfra)
   05215 Prostate cancer
    25267 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    25267 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    25267 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25267 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25267 (Pdgfra)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     25267 (Pdgfra)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   25267 (Pdgfra)
CD molecules [BR:rno04090]
 Proteins
  25267 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Ig_6 Herpes_gE C2-set_2
Other DBs
NCBI-GeneID: 25267
NCBI-ProteinID: NP_036934
RGD: 3284
Ensembl: ENSRNOG00000002244
UniProt: P20786 G3V6A0
Position
14
AA seq 1088 aa
MGTSQAFLVLSCLLTGPSLIVCQLLLPSILPNENEKIVPLSSSFSLRCFGESEVSWQHPM
SEEEDPNVEIRTEENNSSLFVTVLEVVNASAAHTGWYTCYYNHTQTEESEIEGRHIYIYV
PDPDMAFVPLGMTDSLVIVEEDDSAIIPCRTTDPDTEVTLHNNGRLVPASYDSRQGFNGT
FSVGPYICEATVRGRTFKTSEFNVYALKATSELNLEMDTRQTVYKAGETIVVTCAVFNNE
VVDLQWTYPGEVRNKGITMLEEIKLPSIKLVYTLTVPKATVKDSGDYECAARQATKEVKE
MKTVTISVHEKGFVQIRPTFGHLETVNLHQVREFVVEVQAYPTPRISWLKDNLTLIENLT
EITTDVQRSQETRYQSKLKLIRAKEEDSGHYTIIVQNDDDMKSYTFELSTLVPASILELV
DDHHGSGGGQTVRCTAEGTPLPNIEWMICKDIKKCNNDTSWTVLASNVSNIITEFHQRGR
STVEGRVSFAKVEETIAVRCLAKNDLGIGNRELKLVAPTLRSELTVAAAVLVLLVIVIVS
LIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGS
GAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLL
GACTKSGPIYIITEYCFYGDLVNYLHKNRDSFMSRHPEKPKKDLDIFGLNPADESTRSYV
ILSFENNGDYVDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEAKNL
LSDDDSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLAR
DIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGVLLWEIFSLGGTPYPGMMV
DSTFYNKIKSGYRMAKPDHATSEVYEIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYKKS
YEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKEWEGGLDEQRLSADSGYIIP
LPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSS
DLVEDSFL
NT seq 3267 nt   +upstreamnt  +downstreamnt
atggggacctcccaggcctttctggtcctcagctgtctcctcacagggccgagcctcatc
gtctgccagctcttattaccctccatccttccaaatgagaatgagaagattgtgccgctg
agttcgtccttctctctgagatgcttcggggagagcgaagtgagctggcagcaccccatg
tctgaagaagaggaccccaacgtggaaatcagaaccgaggagaacaacagtagcctcttt
gtcacggtgctggaagtggtcaacgcctcagcggcccacaccggatggtacacttgctat
tacaaccacactcagacagaagagagtgagatcgaaggcaggcacatttatatctatgta
ccagacccagacatggccttcgtgcctctcggcatgacggattctttagtcattgtggaa
gaggacgattctgccatcataccctgccgcaccacggatccagacactgaagtaaccttg
cacaataacgggaggctggtgcctgcctcctacgacagcaggcagggcttcaacggaacc
ttcagtgtggggccttacatctgtgaggccaccgtcagagggaggacgttcaagaccagc
gagtttaacgtttatgccttgaaagccacgtcagaactgaatctggagatggacacacgc
cagactgtgtataaggcaggagaaacgatcgtggtgacctgcgccgtctttaacaatgag
gtggttgacctgcagtggacttaccctggagaggtgagaaacaaaggcatcaccatgctg
gaggagatcaaactcccgtccatcaaactggtgtacacgctgaccgtccccaaggccacg
gtgaaggacagtggagattatgaatgtgctgcccgccaggccacgaaagaggtcaaggaa
atgaagacagtcaccatttctgttcacgagaaaggcttcgtccagatcaggcccaccttt
ggccatctggaaactgtgaacctgcatcaggtcagagagttcgtggtggaggtgcaggcc
tacccgacccccaggatatcctggctgaaggacaacttgaccctgattgagaatctcact
gagatcaccaccgatgtgcagaggagccaggagacgaggtatcaaagcaaattaaagctg
atccgggctaaggaagaagacagcggccattataccattatagttcagaatgacgacgac
atgaagagctacacgtttgagctgtcaactctagttcctgcctccattctggagcttgtg
gatgaccaccatggctctggcgggggacagactgtgaggtgcacggctgaaggcacccct
cttccgaacatcgagtggatgatctgcaaggatattaagaaatgtaataatgacacttca
tggacagttttggccagcaacgtctcgaatattatcacggagttccaccagcgaggcagg
agtacagtggagggacgagtgtccttcgccaaggtggaagagaccatcgcagttcggtgc
ttggcaaagaacgaccttggcattgggaacagagagctgaagctggtggctcccaccctg
cgatctgagctcacggtggcggccgcggtgctggtgctgttggtgattgtcattgtctct
ctcattgtcctggttgtcatttggaagcagaaaccacggtatgaaattcgatggagggtc
attgagtcaatcagccctgatggacatgagtatatttatgtggaccccatgcagctgcct
tacgactccagatgggagttcccgagagatggactagtgcttggtcggatcttgggatcc
ggtgcatttgggaaagtggttgaaggcacagcttatggattaagccggtcccagcctgta
atgaaggtggctgtgaagatgctcaaacccacagccaggtctagtgagaagcaagctctc
atgtctgagctgaagataatgactcacttgggaccgcatctgaacattgtgaatttgctg
ggagcctgcaccaagtcaggccccatttacatcatcacagaatactgcttctatggggat
ttggtcaattacctgcataagaacagagatagcttcatgagccgacacccagagaagcca
aagaaagacctggacatctttggattgaatcctgcagatgagagtaccaggagttacgtg
attttatcttttgaaaacaatggtgactacgtggacatgaagcaggctgacaccacacag
tacgtgccaatgctggaaaggaaggaggtttccaaatactccgacatccagagatcgctg
tacgatcggccggcctcctataagaagaaatccatgctagactcagaagctaaaaacctc
ctttcggatgatgactccgagggtctgactttgctggacctactaagcttcacctaccaa
gtggcccgagggatggaatttttggcttcgaaaaattgtgtccaccgggacctggctgcc
cgcaacgtccttctggcgcaggggaaaatcgtgaagatctgtgacttcgggctggccaga
gacatcatgcacgattctaactacgtgtcaaagggcagcactttcctgcctgtgaagtgg
atggcacctgagagcatttttgacaacctctacaccacgctgagtgacgtctggtcttat
ggcgttctgctctgggaaatattctcccttggtggcacaccctaccctggcatgatggtt
gattctactttctacaataagatcaagagcggatacaggatggccaaacccgaccatgcc
accagtgaagtctatgagattatggtgcagtgctggaacagtgaacccgaaaagagaccc
tccttctaccacctcagcgagatagtggagaatctgctgcctggacagtacaaaaagagt
tatgaaaagattcacctggacttcctaaagagtgaccatccggctgtggcacgcatgcgt
gtggactctgacaacgcgtacatcggtgtcacttacaaaaatgaagaggacaagctgaag
gaatgggaaggtggcctggatgaacagagattgagcgcagatagtggctacatcattccc
ctgccagacattgaccctgttccagaggaggaagacctgggcaagaggaacagacacagc
tcgcagacttcggaagagagcgccatcgagacgggttccagtagttccactttcatcaag
agagaggacgagaccattgaggacatcgacatgatggatgatattggcatagattcctca
gacctggtggaggacagcttcctgtaa

KEGG   Rattus norvegicus (rat): 25589
Entry
25589             CDS       T01003                                 

Gene name
Kdr
Definition
(RefSeq) vascular endothelial growth factor receptor 2 precursor
  KO
K05098  kinase insert domain protein receptor [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04370  VEGF signaling pathway
rno04510  Focal adhesion
rno05205  Proteoglycans in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25589 (Kdr)
   04014 Ras signaling pathway
    25589 (Kdr)
   04015 Rap1 signaling pathway
    25589 (Kdr)
   04370 VEGF signaling pathway
    25589 (Kdr)
   04020 Calcium signaling pathway
    25589 (Kdr)
   04151 PI3K-Akt signaling pathway
    25589 (Kdr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25589 (Kdr)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    25589 (Kdr)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25589 (Kdr)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    25589 (Kdr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25589 (Kdr)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25589 (Kdr)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     25589 (Kdr)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   25589 (Kdr)
CD molecules [BR:rno04090]
 Proteins
  25589 (Kdr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set C2-set_2 Ig_5 TCAD9 Haspin_kinase
Other DBs
NCBI-GeneID: 25589
NCBI-ProteinID: NP_037194
RGD: 2965
Ensembl: ENSRNOG00000046829
UniProt: O08775
Position
14
AA seq 1343 aa
MESRALLAVALWFCVETRAASVGLPGDSLHPPKLSTQKDILTILANTTLQITCRGQRDLD
WLWPNTPRDSEERVLVTECGDSIFCKTLTVPRVVGNDTGAYKCFYRDTDVSSIVYVYVQD
HRSPFIASVSDEHGIVYITENKNKTVVIPCRGSISNLNVSLCARYPEKRFVPDGNRISWD
SEKGFTIPSYMISYAGMVFCEAKINDETYQSIMYIVLVVGYRIYDVVLSPPHEIELSAGE
KLVLNCTARTELNVGLDFSWQFPSSKHQHKKIVNRDVKSLPGTVAKMFLSTLTIDSVTKS
DQGEYTCTAYSGLMTKKNKTFVRVHTKPFIAFGSGMKSLVEATVGSQVRIPVKYLSYPAP
DIKWYRNGRPIESNYTMIVGDELTIMEVSERDAGNYTVILTNPISMEKQSHMVSLVVNVP
PQIGEKALISPMDSYQYGTMQTLTCTVYANPPLHHIQWYWQLEEACSYRPSQTNPYTCKE
WRHVKDFQGGNKIEVTKNQYALIEGKNKTVSTLVIQAANVSALYKCEAINKAGRGERVIS
FHVIRGPEITVQPATQPTEQESVSLLCTADRNTFENLTWYKLGSQATSVHMGESLTPVCK
NLDALWKLNGTVFSNSTNDILIVAFQNASLQDQGNYVCSAQDKKTKKRHCLVKQLVILER
MAPMITGNLENQTTTIGETIEVVCPTSGNPTPLITWFKDNETLVEDSGIVLKDGNRNLTI
RRVRKEDGGLYTCQACNVLGCARAETLFIIEGAQEKTNLEVIILVGTAVIAMFFWLLLVI
VLRTVKRANEGELKTGYLSIVMDPDELPLDERCERLPYDASKWEFPRDRLKLGKPLGRGA
FGQVIEADAFGIDKTATCKTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGA
CTKPGGPLMVIVEFCKFGNLSTYLRGKRNEFVPYKSKGARFRSGKDYVGELSVDLKRRLD
SITSSQSSASSGFVEEKSLSDVEEEEASEELYKDFLTLEHLICYSFQVAKGMEFLASRKC
IHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTI
QSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWH
EDPNQRPAFSELVEHLGNLLQANAQQDGKDYIVLPMSETLSMEEDSGLSLPTSPVSCMEE
EEVCDPKFHYDNTAGISHYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDSQTDSGMVL
ASEELKTLEDRNKLSPSFGGMMPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSDEA
GLLKLVDVAGHVDSGTTLRSSPV
NT seq 4032 nt   +upstreamnt  +downstreamnt
atggagagcagggcgctgctagctgtcgctctgtggttctgcgtggagacccgagccgcc
tctgtgggtttgcctggcgattccctccatccacccaagctcagcacacaaaaagacata
cttacaattttggcaaatacaacccttcagattacttgcaggggacagagggacctggat
tggctttggcccaacactccgcgtgactctgaggaaagggtgttggtgactgagtgtggc
gacagtatcttctgcaagacactcacagttcccagagtggttggaaatgatactggagcc
tacaagtgcttctatcgggacaccgatgtctcctccatcgtttatgtctatgttcaagat
cacaggtcaccattcatcgcctctgtcagtgacgagcatggcatcgtgtacatcactgag
aacaagaacaaaactgtggtgatcccatgccgagggtcgatttcaaacctcaacgtgtca
ctttgtgctaggtatccagaaaagagatttgttccggatggaaacagaatttcctgggac
agcgagaaaggctttactatccccagttacatgatcagctatgccggcatggtcttctgt
gaggcaaagattaatgatgaaacgtatcagtctatcatgtacatagttctggttgtagga
tataggatttatgatgtggtcctgagcccccctcatgaaattgagctatctgccggagaa
aagcttgtcttaaattgtacagcaagaacagagctcaacgtggggcttgatttcagctgg
caattcccgtcctcaaagcatcagcataagaagattgtaaaccgggatgtgaaatccctt
cctgggactgtggcaaagatgtttttgagcaccttgaccatagacagtgtgaccaagagt
gaccaaggagaatacacctgcacagcgtacagtggactgatgaccaagaaaaataaaaca
tttgtccgagttcatacaaaaccttttattgcttttggtagcgggatgaaatctttggtg
gaagccactgtgggcagccaagtccgaatccctgtgaagtatctcagttacccagctcct
gatatcaaatggtacagaaatggacgacccattgagtccaattacacaatgatcgttggt
gatgaactcaccatcatggaagtgagtgaaagagatgcgggaaactacacggtcatcctc
accaatcccatttcaatggagaaacagagccacatggtctctctggttgtgaatgttcca
ccccagatcggtgagaaagccttgatctctcctatggattcctaccagtatggcaccatg
cagacgctgacatgcacagtctatgccaaccctcccctgcaccacatccaatggtactgg
cagctagaagaagcatgctcctacaggcccagccaaacaaacccatatacttgtaaagaa
tggagacacgtgaaggatttccaggggggaaataagatcgaagtcaccaaaaaccaatat
gccctaattgaaggaaaaaacaaaactgtaagtactctggtcatccaggctgccaacgtg
tccgcattatacaaatgtgaagccatcaacaaagcaggacgaggagagagggtcatctcc
ttccatgtgatcaggggtcctgaaattactgtccagcctgctacccagccaaccgagcag
gagagtgtgtctctattgtgcactgcagatagaaacacgtttgagaacctcacgtggtac
aagcttggctcacaggcaacatcggtccacatgggcgaatcactcacaccagtttgcaag
aacttggacgctctttggaaactgaatggcaccgtgttttctaacagcacaaacgacatc
ttgattgtggcattccagaatgcctccctgcaggaccaaggcaactatgtctgctctgct
caagacaagaagaccaagaaaagacattgcctagtcaagcagctcgtcatcctagagcgc
atggcacccatgatcactggaaatctggagaatcagacaacaaccattggtgagaccatc
gaagttgtttgtccaacatctggaaaccctacccccctcattacatggttcaaagacaat
gagacccttgtagaagattcaggcattgtactaaaagacgggaaccggaacctaactatc
cgaagggtgaggaaggaagacgggggcctctacacctgccaggcctgcaatgtccttggc
tgtgcaagagcagagacactcttcataatagaaggtgcccaggaaaagaccaacttggaa
gtcattattctcgtcggcactgcagtgatcgccatgttcttctggctacttcttgtcatt
gttctacggaccgttaagcgggccaatgaaggggaactgaagacaggctacttgtccatt
gtcatggatccagatgaactgcccttggatgagcgctgtgaacgcttgccttatgatgcc
agcaagtgggagttccccagggaccggctgaaactaggaaaacctcttggccgtggtgcc
tttggccaagtgattgaggcagatgcctttggaatcgacaagacagcgacttgcaaaaca
gtggctgtcaagatgttgaaagagggagcaacacacagcgagcaccgagccctcatgtcc
gaactcaagatcctcatccacattggccaccatctcaatgtggtgaacctgctgggtgcc
tgcacgaagcccggagggcctctcatggtgattgtagaattctgcaagtttggaaaccta
tcaacttacttacggggcaagagaaatgaattcgtgccctataagagcaaaggggcacgc
ttccgctctgggaaagactatgttggggagctctccgtagacctgaagcggcgcttggac
agcatcaccagcagtcagagctctgccagctcaggttttgtggaggagaaatccctcagt
gacgtagaggaagaagaagcttctgaagaactctacaaggacttcctgaccttggagcat
ctcatctgttacagcttccaagtggctaagggcatggagttcttggcatcaaggaagtgt
atccacagggacctggcagcacgaaacattctcctatcggagaagaacgtggttaagatc
tgtgactttggcttggcccgggacatttataaagacccagattacgtcagaaaaggagat
gcccgactccctttgaagtggatggctccggaaacaatttttgacagagtatacacaatt
cagagtgacgtgtggtcttttggtgttttgctctgggaaatattttccttaggtgcttcc
ccatatcctggggtcaagattgatgaagaattttgtaggagattgaaagaaggaacgaga
atgcgggctcctgactacaccaccccagaaatgtaccaaaccatgctggattgctggcat
gaggaccccaaccagagacccgcgttttcagagttggtggagcacttgggaaatctcctg
caagcaaatgctcagcaggatggcaaagactatattgttcttccaatgtcagagacactg
agcatggaagaggattctggactctccctgcctacctcacctgtttcctgtatggaggaa
gaggaagtgtgcgaccccaaattccattatgacaacacagcaggaatcagtcattatctg
cagaacagcaagcgaaaaagccggccagtgagtgtaaaaacatttgaagatatccctttg
gaggaaccagaagtaaaagtgattccagatgacagccagacagacagtgggatggtcctt
gcctcagaagagctgaaaactctggaagacaggaacaaattatctccatcttttggtggg
atgatgcccagtaaaagcagggagtctgtggcctcggaaggctccaaccagaccagcggc
taccagtctgggtatcactcagacgacacagataccaccgtgtactccagcgacgaggca
ggacttttaaagctggtggatgttgcagggcacgttgactctgggaccacactgcgctca
tctcctgtttaa

KEGG   Rattus norvegicus (rat): 25718
Entry
25718             CDS       T01003                                 

Gene name
Igf1r
Definition
(RefSeq) insulin-like growth factor 1 receptor precursor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04114  Oocyte meiosis
rno04140  Autophagy - animal
rno04144  Endocytosis
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04510  Focal adhesion
rno04520  Adherens junction
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04730  Long-term depression
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05205  Proteoglycans in cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    25718 (Igf1r)
   04014 Ras signaling pathway
    25718 (Igf1r)
   04015 Rap1 signaling pathway
    25718 (Igf1r)
   04066 HIF-1 signaling pathway
    25718 (Igf1r)
   04068 FoxO signaling pathway
    25718 (Igf1r)
   04151 PI3K-Akt signaling pathway
    25718 (Igf1r)
   04152 AMPK signaling pathway
    25718 (Igf1r)
   04150 mTOR signaling pathway
    25718 (Igf1r)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25718 (Igf1r)
   04140 Autophagy - animal
    25718 (Igf1r)
  09143 Cell growth and death
   04114 Oocyte meiosis
    25718 (Igf1r)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25718 (Igf1r)
   04520 Adherens junction
    25718 (Igf1r)
   04550 Signaling pathways regulating pluripotency of stem cells
    25718 (Igf1r)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    25718 (Igf1r)
   04914 Progesterone-mediated oocyte maturation
    25718 (Igf1r)
  09156 Nervous system
   04730 Long-term depression
    25718 (Igf1r)
  09149 Aging
   04211 Longevity regulating pathway
    25718 (Igf1r)
   04213 Longevity regulating pathway - multiple species
    25718 (Igf1r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25718 (Igf1r)
   05202 Transcriptional misregulation in cancer
    25718 (Igf1r)
   05205 Proteoglycans in cancer
    25718 (Igf1r)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    25718 (Igf1r)
   05214 Glioma
    25718 (Igf1r)
   05218 Melanoma
    25718 (Igf1r)
   05215 Prostate cancer
    25718 (Igf1r)
   05224 Breast cancer
    25718 (Igf1r)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    25718 (Igf1r)
   01522 Endocrine resistance
    25718 (Igf1r)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    25718 (Igf1r)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25718 (Igf1r)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     25718 (Igf1r)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   25718 (Igf1r)
CD molecules [BR:rno04090]
 Proteins
  25718 (Igf1r)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD B2 DUF4476
Other DBs
NCBI-GeneID: 25718
NCBI-ProteinID: NP_434694
RGD: 2869
Ensembl: ENSRNOG00000014187
UniProt: P24062
Position
1
AA seq 1370 aa
MKSGSGGGSPTSLWGLVFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGFLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTIDWSLILDAVSNNYIVGNKPPKECGD
LCPGTLEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSVCGKRACTENNECCHPECLGSCH
TPDDNTTCVACRHYYYKGVCVPACPPGTYRFEGWRCVDRDFCANIPNAESSDSDGFVIHD
GECMQECPSGFIRNSTQSMYCIPCEGPCPKVCGDEEKKTKTIDSVTSAQMLQGCTILKGN
LLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYS
FYVLDNQNLQQLWDWNHRNLTVRSGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINT
RNNGERASCESDVLRFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYD
GQDACGSNSWNMVDVDLPPNKEGEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKS
EILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPTLPNGNLSYYIVRWQRQPQDGYLFR
HNYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGDKGPCCACPKTEAEKQAEKEEAEYR
KVFENFLHNSIFVPRPERRRRDVLQVANTTMSSRSRNTTVADTYNITDPEEFETEYPFFE
SRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVT
WEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPG
NYTARIQATSLSGNGSWTDPVFFYVPAKTTYENFMHLIIALPVAILLIVGGLVIMLYVFH
RKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMNRELGQGSFGMVYEGVAK
GVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIM
ELMTRGDLKSYLRSLRPEVENNLVLIPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAAR
NCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFG
VVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSF
LEIIGSIKDEMEPSFQEVSFYYSEENKPPEPEELEMELELEPENMESVPLDPSASSASLP
LPERHSGHKAENGPGVLVLRASFDERQPYAHMNGGRANERALPLPQSSTC
NT seq 4113 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcgtgtttctctcc
gccgcgctctcgctctggccgacgagtggagaaatttgtgggcccggcattgacatccgc
aacgactatcagcagctgaagcgcctggaaaactgcacggtgatcgagggcttcctccac
atcctgctcatctccaaggccgaggactaccgaagctaccgcttccccaagctcacggtc
atcaccgagtacttgctgctgtttcgagtggccggcctcgagagcctgggagacctcttc
ccgaacctcacagtcatccgtggctggaaactcttctacaattacgcactggtcatcttc
gagatgaccaatctcaaggatattgggctttataatctgaggaacattactcggggggcc
atcaggattgagaaaaacgctgacctctgttacctctccaccatagactggtctctcatc
ttggatgcggtgtccaataactacattgtggggaacaagcccccaaaggaatgtggggac
ctgtgtccagggaccttggaggagaagcccatgtgtgagaagaccaccatcaacaatgag
tacaactaccgctgctggaccacaaatcgctgccagaaaatgtgcccaagtgtgtgtggg
aagcgagcctgcaccgagaacaatgagtgctgccacccggagtgcctaggcagctgccac
acaccggacgacaacacaacctgcgtggcctgccgacactactactacaaaggcgtgtgc
gtgcctgcctgcccgcctggcacctacaggttcgagggctggcgctgtgtggaccgggat
ttctgcgccaacatccccaacgccgagagcagtgactcagatggcttcgtcatccacgat
ggcgagtgcatgcaggagtgtccatcaggcttcatccgcaacagcacccagagcatgtac
tgtatcccctgtgaaggcccctgccccaaggtctgcggcgatgaagaaaagaaaacgaaa
accatcgattctgtgacgtctgcccagatgctccaagggtgcaccattttgaagggcaat
ctgcttattaacatccggcgaggcaataacattgcctcggaattggagaacttcatgggg
ctcatcgaggtggtgactggctacgtgaagatccgccattcccatgccttggtctccttg
tccttcctgaagaaccttcgtctcatcttaggagaggagcagctagaagggaactactcc
ttctatgtcctggacaaccagaacttgcagcagctgtgggactggaaccaccggaacctg
accgtcaggtcagggaaaatgtacttcgctttcaatcccaagctgtgtgtctctgaaatt
taccggatggaggaggtgacaggaacaaagggacggcagagcaaaggagacataaacacc
aggaacaacggagagcgagcttcctgtgaaagtgatgttctccgtttcacctccaccacc
acctggaagaaccgcatcatcataacgtggcaccggtaccggccgccggactaccgggat
ctcatcagtttcacagtctactacaaggaggcaccctttaaaaacgtcacggaatacgac
gggcaggatgcctgtggctccaacagctggaacatggtggacgtggacctgcctccgaac
aaggagggggagcctggcattttgctgcatgggctgaagccctggacccagtatgcagtc
tatgtcaaggctgtgaccctcaccatggtggaaaacgaccacatccgtggggccaaaagt
gaaatcttgtacattcgcaccaacgcttcagttccttccattcctctagatgtcctctcg
gcatcaaactcctcctctcagctgatcgtgaagtggaaccccccaactctgcccaatggt
aacttgagttactacattgtgaggtggcagcggcagccgcaggatggctatctgttccgg
cacaactactgctccaaagacaaaatacccatcagaaagtacgccgatggtaccatcgat
gtggaggaggtgacagaaaatcccaagacagaagtgtgcggtggtgataaagggccgtgc
tgtgcctgtcctaaaaccgaagctgagaagcaggctgagaaggaggaggctgagtaccgt
aaagtctttgagaatttccttcacaactccatctttgtgcccagacctgagaggaggcgg
agagatgtcctgcaggtggctaacaccaccatgtccagccgaagcaggaacaccacggta
gctgacacctacaatatcacagacccggaagagttcgagacagaataccctttctttgag
agcagagtggataacaaggagaggactgtcatttccaacctccggcctttcactctgtac
cgtatcgatatccacagctgcaaccacgaggctgagaagctgggctgcagcgcctccaac
tttgtctttgcaagaaccatgccagcagaaggagcagatgacattcctggcccagtgacc
tgggagccaagacctgaaaactccatctttttaaagtggccagaacccgagaaccccaac
ggattgattctaatgtatgaaataaaatacggatcgcaagtcgaggatcagcgggaatgt
gtgtccagacaggagtacaggaagtatggaggggccaaacttaaccgtctaaacccaggg
aactatacggcccggattcaggctacctccctctctgggaatgggtcgtggacagatcct
gtgttcttctatgtcccagccaaaacaacgtatgagaatttcatgcatctgatcattgct
ctgccggttgccatcctgctgattgtggggggcctggtaatcatgctgtatgtcttccat
agaaagaggaataacagcagattgggcaacggggtgctgtacgcctctgtgaaccccgag
tatttcagcgcagctgatgtgtacgtgcctgatgaatgggaggtagctcgggagaagatc
accatgaaccgggagctcggacaagggtccttcgggatggtctatgaaggagtggccaag
ggcgtggtcaaggacgagcctgaaaccagagtggccatcaagacagtgaatgaggctgca
agtatgcgtgagagaattgagtttctcaacgaggcctcagtgatgaaggagttcaactgt
caccatgtggtccggttgctgggtgtagtatcccaaggccagcccaccctggtcatcatg
gaactaatgacacgtggcgatctcaaaagttatctccggtctctaaggccagaggtggag
aataatctagtcctgattcctccgagcttaagcaagatgatccagatggctggagagatt
gcagatggcatggcctacctcaatgccaacaagttcgtccacagagacctggctgctcgg
aactgcatggtagctgaagatttcacagtcaaaattggagattttggtatgacacgagac
atctacgagacggactactaccggaaaggcgggaagggcttgctgcctgtgcgctggatg
tctcccgagtccctcaaggatggcgtcttcaccactcattccgatgtctggtcctttggg
gtcgtcctctgggagatcgccactctggctgagcagccgtaccagggcctgtccaacgag
caagttcttcgtttcgtcatggagggcggccttctggacaagccggataactgccccgat
atgctgtttgaacttatgcgcatgtgctggcagtacaaccccaagatgcggccctccttc
ctggagatcatcggaagcatcaaggatgagatggagcccagtttccaggaggtctccttc
tactacagcgaggagaacaagcctccagagccggaggagctggagatggagctggagctg
gagcccgagaacatggagagcgtcccgctggacccttcggcctcctcagcctccctgcct
ctgcctgaaagacactcaggacacaaggctgagaacggccctggcgtgctggttctccgt
gccagttttgatgagagacagccttacgctcacatgaatgggggacgcgccaacgagagg
gccttgcctctgccccagtcctcaacctgctga

KEGG   Rattus norvegicus (rat): 307403
Entry
307403            CDS       T01003                                 

Gene name
Csf1r
Definition
(RefSeq) macrophage colony-stimulating factor 1 receptor precursor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04151  PI3K-Akt signaling pathway
rno04380  Osteoclast differentiation
rno04640  Hematopoietic cell lineage
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    307403 (Csf1r)
   04014 Ras signaling pathway
    307403 (Csf1r)
   04015 Rap1 signaling pathway
    307403 (Csf1r)
   04151 PI3K-Akt signaling pathway
    307403 (Csf1r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    307403 (Csf1r)
   04061 Viral protein interaction with cytokine and cytokine receptor
    307403 (Csf1r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    307403 (Csf1r)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    307403 (Csf1r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    307403 (Csf1r)
   05202 Transcriptional misregulation in cancer
    307403 (Csf1r)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    307403 (Csf1r)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    307403 (Csf1r)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    307403 (Csf1r)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     307403 (Csf1r)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   307403 (Csf1r)
CD molecules [BR:rno04090]
 Proteins
  307403 (Csf1r)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Ig_6
Other DBs
NCBI-GeneID: 307403
NCBI-ProteinID: NP_001025072
RGD: 2425
Ensembl: ENSRNOG00000018414
UniProt: D4ACA7
Position
18
AA seq 1022 aa
MELGAPLVLLLATAWHGVQILSGEKSRTTIHIYLLAGRRAVTTEIVLMGQRSTDVQRVND
CQGAPVIEPSGPELVVEPGATVTLRCVSNGSVEWDGPISPYWTLDSESPGSILITKNATF
KNTGTYRCTELEDPMRGSTAIHLYVKDPVRPWNLLAQEVTVFEGQEAVLPCLITDPTLKD
SVSLVREWGRPVSRKTVYSFLPWRGFIIHKAKFLDSHTYMCKAVVNARESTSIGIRLKVN
RAHPGPPHIILEPTKLVRIRGEAAQIVCSATHSEVEFNVILKRGDTKLEIPINSDFQDNA
YKKVLTLNLNAVDFQDAGIYSCVANNAAGSNTATMNFQVVESAYLNLTSEQSLLQEVSVG
ENLDLTVIADAYPGLQRYNWTYLGPFFEDPHNLEFRTQWTTYSYSFKLHLNRVKPLEAGR
YSLMAQNKAGWNNLTFELTLRYPPEVSVTWIPVNGSDVLLCDVSGYPQPNVTWMECRGHT
DRCDEAQASQVWDDTQPEVLSQKPFHRVILQSQLPIGTLKHNMTYVCRAHNNVGNSSQFF
RAISLGQSKQLPDEYLFTPVVVACISVMSLLVLLLLLLLYKYKQKPKYQVRWKIIESYEG
NNYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKML
KSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRK
AEAMLGPSLSPGQDPEGDSSYKNIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSNDSFF
KQDLDKEASRPLELWDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTSGHVAKIGDFG
LARDIMNDSNYVVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPG
ILVNNKFYKLVKDGYQMAQPVFAPENIYSIMQSCWDLEPTKRPTFQQICFLLQEQARLER
REQDYANLPSSSSSSSSSSDSGGGSGGSSSEPEEESSSEHLACCEPGDIAQPLLQPNNYQ
FC
NT seq 3069 nt   +upstreamnt  +downstreamnt
atggagctgggggctcctctggtcctgctgctggccacagcttggcatggagtgcagatt
ttatctggggagaagagtaggaccaccatccacatctaccttctggcaggcaggagggcg
gtgaccactgagattgttctcatgggtcagaggagcactgatgtccagagggtcaatgac
tgtcaaggggcccctgtcatcgagcctagtggcccagagctggttgtagagccaggtgca
acagtgaccctgcgatgtgtgagcaatggcagtgtggaatgggatggccccatctctccc
tactggaccttggactctgaatctcctggaagcatcctgatcacaaaaaacgccaccttc
aaaaacactgggacctaccgttgtactgagcttgaagaccctatgcggggcagtaccgcc
atccacttgtacgtcaaagatcctgtccggccctggaatttgctagcacaggaggtgaca
gtgtttgagggccaggaagctgtgctgccctgtctgatcactgaccccacactgaaggac
agtgtctcactggtgagggagtggggcagaccagtctcacgcaaaacggtctactccttc
ttaccatggcgagggttcattatccacaaggctaaattccttgacagtcatacctacatg
tgcaaggctgttgtgaacgctagggaatccacctccattggcatccggcttaaggtgaat
cgagcccacccagggcccccacacatcatattggaacctactaagctggtgaggattcga
ggggaggctgcccagatcgtgtgctcggccactcactcagaagttgaattcaacgttatc
ctcaaacgtggagacaccaagttggaaatccccataaacagtgacttccaagacaacgct
tataaaaaggtcctgactcttaacctcaatgctgtggacttccaagatgctggcatatat
tcctgtgtggccaacaacgcagctggctcgaacacggccaccatgaacttccaggtggtg
gagagtgcctacttaaacttgacctctgagcagagcctcttgcaggaggtgtctgtgggt
gagaacctcgacctcacagtcattgcagatgcctaccctggcctacagcgttacaactgg
acctacctagggccgttctttgaagacccacacaatcttgagtttagaacccaatggacc
acatacagctactcattcaaactccacctgaaccgtgtaaagcccttggaggccggccgc
tactccttaatggcacaaaacaaggcaggctggaataatctgacctttgagctcaccctg
cgataccccccagaagtcagtgttacatggatacctgtgaacggctctgatgtcctgctc
tgtgatgtctctgggtatcctcagcccaacgtgacatggatggagtgcaggggccacacc
gataggtgtgatgaggcccaggcctcgcaggtttgggatgacacacaacctgaagtcctg
agtcagaagcccttccacagagtgatccttcagagccagctgcccattgggaccctaaag
cacaacatgacttatgtttgcagagcccacaacaatgtgggtaacagctcccagttcttc
agggccatctccctaggacaaagcaagcagctccctgatgagtacctgttcactccagtg
gtggtggcctgtatatctgtcatgtctctgctggtactactgctgctgctgctcttgtac
aagtacaagcagaagccgaaatatcaggtgcgctggaagatcattgagagctacgagggc
aacaactacaccttcatcgaccctacccagttgccctacaatgagaagtgggagtttccc
cggaacaacctgcaatttggtaagactctcggagctggtgcctttgggaaggtggtggag
gccacagcctttggtctgggcaaagaagatgcagtgctgaaggtggctgtgaagatgctc
aagtccacggctcatgccgatgagaaggaggccctaatgtcagaactgaagatcatgagt
cacctgggacagcatgagaacattgtcaacctcttgggagcctgtactcatggagggcct
gtcctggtcatcaccgaatactgctgctacggagaccttctcaacttccttcgaaggaag
gccgaggctatgctgggacccagcctgagtcctggtcaggaccccgagggggactccagc
tacaagaacatccacctggagaagaaatatgtgcgcagggacagtggcttctccagtcag
ggcgtagatacctatgtggagatgaggcctgtttcgacttcctcaaatgactccttcttt
aagcaagatctggacaaagaggccagccggccgctggagctctgggacctgcttcacttc
tctagccaagtggctcagggcatggctttccttgcttctaaaaattgcatccatcgtgat
gtagctgctcgaaatgtgctgttgaccagcggacatgtggccaagattggggactttggg
ctggctagggacatcatgaatgactctaactatgttgtcaagggcaatgcccgcctgcct
gtaaagtggatggccccagagagcatcttcgactgcgtctacacagttcagagtgatgtg
tggtcctacggcatcctcctctgggagattttctcacttggtctgaacccctacccaggc
atcttagtgaacaacaagttctacaaactggtgaaggatggataccaaatggcccagcct
gtatttgcaccggagaacatatacagcatcatgcagtcctgctgggacctggagcctacc
aaaagacctaccttccagcagatctgcttcctcctccaggaacaggcccgactggagagg
agagagcaggactatgctaacctgccaagcagcagcagcagcagtagcagcagcagtgac
agtggtggtggcagtggtggtagcagcagtgagcctgaagaggagagctccagtgagcac
ctggcctgctgtgagccaggggacatcgcccagcccctgctgcagcctaacaactaccag
ttctgctga

KEGG   Rattus norvegicus (rat): 366492
Entry
366492            CDS       T01003                                 

Gene name
Epha2
Definition
(RefSeq) ephrin type-A receptor 2 precursor
  KO
K05103  Eph receptor A2 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    366492 (Epha2)
   04014 Ras signaling pathway
    366492 (Epha2)
   04015 Rap1 signaling pathway
    366492 (Epha2)
   04151 PI3K-Akt signaling pathway
    366492 (Epha2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    366492 (Epha2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    366492 (Epha2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     366492 (Epha2)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   366492 (Epha2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Pur_ac_phosph_N Interfer-bind ABC1 Ephrin_rec_like Haspin_kinase SKG6 SAM_KSR1
Other DBs
NCBI-GeneID: 366492
NCBI-ProteinID: NP_001102447
RGD: 1307204
Ensembl: ENSRNOG00000009222
UniProt: D3ZBN3
Position
5
AA seq 977 aa
MKLRAAGFCLALLWGCALAAAAAQGKEVVLLDFAAMKGELGWLTHPYGKGWDLMQNIMND
MPIYMYSVCNVVSGDQDNWLRTNWVYREEAERIFIELKFTVRDCNSFPGGASSCKETFNL
YYAESDVDYGTNFQKRQFTKIDTIAPDEITVSSDFEARNVKLNVEERMVGPLTRKGFYLA
FQDIGACVALLSVRVYYKKCPEMLQSLARFPETIAVAVSDAQPLATVAGTCVDHAVVPYG
GEGPLMHCTVDGEWLVPIGQCLCQEGYEKVEDACQACSPGFFKSEASESPCLQCPEHTLP
STEGATSCQCEEGYFRAPEDPLSMPCTRPPSAPHYLTAIGMGAKVELRWTAPQDTGGRKD
IVYSVTCEQCWPESGECGSCEASVQYSEPPQALTRTSVTVSDLEPHMNYTFTVEARNGVS
DLVNSRSFRTASVSINQTEPPKVRLEDRSTTSLSVAWSIPVPQQSRVWKYEVTYRKKGDA
NSYNVHRTDGFSVTLDGLAPGTTYLVQVQALTQEGQGAGSKVHEFQTLSTEGSATMAVIG
GVAVGVVLLLVLAGIGFFIHRRRRNLRARQSSEDVYFSKSEQLKPLKTYVDPHTYEDPNQ
AVLKFTTEIHPSCVSRQKVIGAGEFGEVYKGTLKSSSGKKEIPVAIKTLKAGYTEKQRVD
FLSEASIMGQFSHHNIIRLEGVVSKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGM
LRGIASGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKI
PIRWTAPEAISYRKFTSASDVWSYGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTP
MDCPSAIYQLMMQCWQQERSRRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTS
GSEGVPFRTVSEWLESIKMQQYTEHFMVAGYTAIEKVVQMSNDDIKRIGVRLPGHQKRIA
YSLLGLKDQVNTVGIPI
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgaagcttcgggcagccggtttctgcctggccctgttgtggggttgcgcgctggcggcc
gcggcggcacagggaaaagaagttgttttgctggacttcgcagcaatgaagggggaactc
ggctggctcacacacccctacggaaaagggtgggacctgatgcaaaacatcatgaatgac
atgcctatctacatgtactccgtgtgcaatgtggtgtctggcgaccaggacaactggctc
cgtaccaactgggtgtaccgggaggaggccgagcgcatctttattgagctcaagttcacc
gtgcgagactgcaatagctttccgggtggcgccagctcctgcaaagagaccttcaacctc
tactatgcagagtcagacgtggactatggcaccaacttccagaagcgccagttcaccaag
atcgacaccatcgcccctgacgagatcacggtcagcagtgacttcgaggctcgcaatgtc
aagctgaatgtggaggagcgcatggtggggccccttacccggaagggcttctacctggcc
ttccaggacatcggtgcctgtgtggcattgctctctgttcgtgtctactacaagaagtgt
cccgagatgcttcagagcttggcccgcttccctgagaccattgctgtcgccgtctcagat
gcacagcccctggccacggtggccggtacctgcgtggaccacgctgtggtgccttatggg
ggcgaggggcctctcatgcactgcacggtggatggtgagtggctggtgcctatcgggcag
tgcctgtgccaagaaggctacgagaaggtggaggacgcctgccaagcctgttctccagga
ttcttcaagtctgaggcatctgagagcccttgcctgcagtgtccggagcataccctgcca
tccactgagggtgccacctcctgccagtgtgaagaaggctatttcagggcacctgaggac
ccactgtccatgccctgcacacgtccaccctctgccccccactacctcacggccatcggc
atgggtgccaaagtagaactgcgttggacggccccccaggacaccggtgggcgcaaggac
atcgtctacagcgtcacttgcgaacagtgctggccagagtccggcgagtgtgggtcctgt
gaggccagtgtgcaatactcagaaccacctcaggccctgacccgcacgagtgtgacagtc
agcgacctggagcctcacatgaactataccttcactgtcgaagcccgcaatggcgtctca
gacctggtgaatagccgaagcttccggactgccagtgtcagcattaaccaaacagagccc
cccaaggtgagactggaggaccgaagcaccacctccctgagtgtcgcctggagcatcccg
gtgccacagcagagccgtgtgtggaagtacgaagtcacctaccgcaagaagggggatgcc
aatagctacaatgtgcaccgtacagacggcttctccgtgaccctggatggccttgctccc
ggtactacatacctggtgcaggtgcaggcgctgacgcaggagggccagggcgccggcagc
aaagtgcacgagttccagacgctgtccacggaaggatctgccaccatggcggtgatcggc
ggtgtggctgttggcgttgtcctgctcctagtgttagcgggaattggcttcttcatccat
cgaaggaggaggaacctgcgggcccgtcagtcctctgaggacgtctacttttccaagtca
gaacaactaaagcccctgaagacatatgtggatcctcacacttacgaagaccccaaccag
gccgtgctcaagtttaccaccgagatccacccatcctgtgtctccaggcagaaggtcatt
ggagcaggagagtttggagaggtatataaagggacgctgaagtcctcctctgggaagaag
gagataccggtggctatcaagacgctgaaagccggctacactgagaagcagcgggtggac
ttcctaagtgaagccagcatcatgggccagttcagccatcacaatatcatccgcctggag
ggcgttgtctctaaatacaaacccatgatgattatcacagagtacatggagaatggagcg
ctagacaagttccttagggagaaggacggcgagttcagcgtactgcagctcgtgggcatg
cttcggggcatcgcgtctggcatgaagtacctggccaacatgaactacgtgcaccgggac
ctggccgcccgcaacatccttgtcaacagtaacctggtatgcaaggtgtccgattttggc
ctgtcgcgtgtgctggaggatgaccctgaggccacctacaccactagtggcggcaagatt
cctattcgatggacagccccagaagccatttcctaccgcaagttcacctcagccagtgat
gtgtggagctatggaattgtcatgtgggaggtgatgacgtacggagagcggccctattgg
gagctgtcaaaccatgaggtcatgaaagccatcaacgatggcttccggctccccacgccc
atggactgcccctcagccatctaccaactcatgatgcaatgctggcagcaagagcgctcc
cgccggcccaagtttgctgacattgttagcatcttggacaagctcatccgagcccccgac
tccctcaagaccctggctgacttcgatccccgagtgtccattcggctacccagcaccagc
ggctcagagggagtccccttccggacggtgtctgagtggctggaaagcatcaaaatgcaa
cagtatacggaacacttcatggtagctggctacacggccatcgagaaagtggtgcagatg
tccaatgatgacatcaaaaggatcggagtgcgtcttcctggccaccagaagcgcattgcc
tacagcctgctgggactcaaagaccaagtgaacacagtggggattcctatctga

KEGG   Rattus norvegicus (rat): 54251
Entry
54251             CDS       T01003                                 

Gene name
Flt1
Definition
(RefSeq) vascular endothelial growth factor receptor 1 isoform 2 precursor
  KO
K05096  FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04066  HIF-1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno05202  Transcriptional misregulation in cancer
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    54251 (Flt1)
   04014 Ras signaling pathway
    54251 (Flt1)
   04015 Rap1 signaling pathway
    54251 (Flt1)
   04066 HIF-1 signaling pathway
    54251 (Flt1)
   04020 Calcium signaling pathway
    54251 (Flt1)
   04151 PI3K-Akt signaling pathway
    54251 (Flt1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    54251 (Flt1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    54251 (Flt1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    54251 (Flt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    54251 (Flt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     54251 (Flt1)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   54251 (Flt1)
SSDB
Motif
Pfam: Ig_3 I-set ig Ig_2 V-set C1-set Ig_6 Herpes_gE
Other DBs
NCBI-GeneID: 54251
NCBI-ProteinID: NP_001296310
RGD: 2621
Ensembl: ENSRNOG00000000940
Position
12
AA seq 687 aa
MVSCWDTAVLPCALLGCLLLTGYCSGSKLKGPELSLKGTQHVMQAGQTLFLKCRGEAAHS
WSLPTTVSQEDKKLSVTRSACGRNNRQFCSTLTLNMAQANHTGLYSCRYLPKSTSKEKKM
ESAIYIFVSDAGSPFIEMHSDIPKLVHMTEGRELIIPCRVTSPNITVTLKKFPFDALTPD
GQRIAWDSRRGFIIANATYKEIGLLTCEATVNGHLYQTSYLTHRQTNTILDVQISPPSPV
RFLRGQTLVLNCTVTTDLNTRVQMSWNYPGKATKRASIRQRIDQSNPHSNVFHSVLKINN
VESRDKGLYTCRVKSGSSFRTFNTSVHVYEKGFISVKHRKQQVQETIAGKRSHRLSMKVK
AFPSPEVVWLKDGVPATEKSARYSVHGYSLIIKDVTAEDAGDYTILLGIKQSKLFRNLTA
TLIVNVKPQIYEKSVSSLPSPPLYPLGSRQVLTCTVYGIPQPTIKWLWHPCHYNHSKERN
DFCFGSEESFILDSSSNIGNRIEGITQRMMVIEGTNKTVSTLVVADSRTPGIYSCKAFNK
IGTVERDIRFYVTDVPNGFHVSLEKIPTEGEDLKLSCVVSKFLYRDITWILLRTVNNRTM
HHSISKQKMATTQDYSITLNLVIKNVSLEDSGTYACRARNIYTGEEILRKTEVLVRGEHC
SKKAIFSRISEFKSRRSGCATQSNVKH
NT seq 2064 nt   +upstreamnt  +downstreamnt
atggtcagctgctgggacaccgcggtcctgccttgcgcgctgctcgggtgtctgcttctc
acaggatattgttcagggtcgaagttaaaaggaccagaactgagtttaaaaggcacccag
cacgtcatgcaagcgggccagactctctttctcaagtgcagaggggaggcagcccactcc
tggtctctgcctactacagtgagccaggaggacaaaaagctgagcgtcactagatcagcc
tgtggaaggaataacagacaattctgcagcaccttgaccttgaacatggcgcaggccaac
cacacgggcctctactcctgcagatacctgcctaaatccacctcgaaggaaaagaaaatg
gaatctgcaatctacatatttgttagtgatgcagggagtcctttcatagagatgcacagt
gacatacccaaactcgtgcacatgacagaaggaagagagctcatcatcccctgccgggtg
acgtctcccaacatcacagtcactctaaaaaagtttccatttgacgctcttacccctgac
gggcaaagaatagcgtgggacagtaggagaggctttataatagcaaatgcaacgtacaaa
gagataggactgctgacctgcgaagccacagttaacgggcacctgtaccagacaagttat
ctgacccatcggcagaccaatacaatcctagatgtccaaataagcccaccgagccccgtg
agattcctccgtggtcaaactcttgtcctcaactgcaccgtcaccacggacctcaataca
agggtgcagatgagctggaattaccctggtaaagcaactaagagagcatctatcaggcag
cggattgaccaaagcaatccccacagcaatgtgttccacagcgttcttaagatcaacaac
gtggagagccgggacaagggactctacacttgtcgtgtgaagagtgggtcgtcattccgg
actttcaacacctctgtgcatgtgtatgaaaagggatttatcagcgtgaagcatcggaag
caacaggtgcaggaaaccatagcaggaaaacggtcccatcggctgtccatgaaagtgaag
gccttcccctcgccagaagtcgtatggttaaaagatggcgtacccgcaacggagaaatct
gctcgctattcggtgcatggctactcgttaattatcaaagatgtaactgccgaggacgca
ggggactatacaatcttgctgggcataaaacagtcaaagctatttagaaacctcacagcc
actctcatcgtaaatgtgaaacctcagatctacgaaaagtccgtgtcgtcccttccaagc
ccacctctctacccactgggcagcagacaagtcctcacttgcaccgtgtatggcatccct
cagcctaccatcaagtggctgtggcacccctgtcactacaaccactccaaagaaaggaat
gacttctgctttgggagtgaagaatccttcatcctggattccagcagcaacataggaaac
agaatcgagggcatcactcagcgcatgatggtcatagaaggaaccaataagacggttagc
acattggtggtggctgactctcggacccctggaatctacagctgcaaggccttcaataaa
atagggactgtggagagagacataaggttttacgtcacagatgtgccaaacggctttcac
gtttccttggaaaagataccaaccgaaggagaggacctgaaactgtcctgtgtggtcagt
aaattcctgtacagagacattacctggatcctgctacggacagttaacaacaggaccatg
caccatagcatcagtaagcaaaaaatggccaccactcaggactactccatcactctgaac
cttgtcatcaagaatgtgtctctggaagactcgggcacctatgcctgcagagccaggaac
atatacacaggggaagagatccttcggaagacagaagttctcgttagaggtgagcactgc
agcaaaaaggctattttctctcggatctccgaatttaaaagcaggaggagtggttgtgcc
acacaaagtaatgtcaaacattaa

KEGG   Rattus norvegicus (rat): 64030
Entry
64030             CDS       T01003                                 

Gene name
Kit
Definition
(RefSeq) mast/stem cell growth factor receptor Kit precursor
  KO
K05091  proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04640  Hematopoietic cell lineage
rno04916  Melanogenesis
rno05200  Pathways in cancer
rno05221  Acute myeloid leukemia
rno05224  Breast cancer
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    64030 (Kit)
   04014 Ras signaling pathway
    64030 (Kit)
   04015 Rap1 signaling pathway
    64030 (Kit)
   04072 Phospholipase D signaling pathway
    64030 (Kit)
   04151 PI3K-Akt signaling pathway
    64030 (Kit)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    64030 (Kit)
  09152 Endocrine system
   04916 Melanogenesis
    64030 (Kit)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64030 (Kit)
   05230 Central carbon metabolism in cancer
    64030 (Kit)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    64030 (Kit)
   05224 Breast cancer
    64030 (Kit)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    64030 (Kit)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    64030 (Kit)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     64030 (Kit)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   64030 (Kit)
CD molecules [BR:rno04090]
 Proteins
  64030 (Kit)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Ig_6 Ig_5 V-set Pkinase_fungal C1-set APH DUF2039
Other DBs
NCBI-GeneID: 64030
NCBI-ProteinID: NP_071600
RGD: 620568
Ensembl: ENSRNOG00000002227
Vega: OTTRNOG00000001677
UniProt: Q63116
Position
14
AA seq 978 aa
MRGARGAWDLLCVLLVLLRGQTGTSQPSASPGEPSPPSIQPAQSELIVEAGDTIRLTCTD
PAFVKWTFEILDVRIENKQSEWIREKAEATHTGKYTCVSGSGLRSSIYVFVRDPAVLFLV
GLPLFGKEDNDALVRCPLTDPQVSNYSLIECDGKSLPTDLKFVPNPKAGITIKNVKRAYH
RLCIRCAAQREGKWMRSDKFTLKVRAAIKAIPVVSVPETSHLLKEGDTFTVICTIKDVST
SVDSMWIKLNPQPQSKAQVKRNSWHQGDFNYERQETLTISSARVNDSGVFMCYANNTFGS
ANVTTTLKVVEKGFINIFPVKNTTVFVTDGENVDLVVEFEAYPKPEHQQWIYMNRTPTNR
GEDYVKSDNQSNIRYVNELRLTRLKGTEGGTYTFLVSNSDVSASVTFDVYVNTKPEILTY
DRLMNGRLQCVAAGFPEPTIDWYFCTGAEQRCTVPVPPVDVQIQNASVSPFGKLVVQSSI
DSSVFRHNGTVECKASNAVGKSSAFFNFAFKGNSKEQIQPHTLFTPLLIGFVVTAGLMGI
IVMVLAYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAG
AFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLG
ACTVGGPTLVITEYCCYGDLLNFLRRKRDSFIFSKQEEQADAALYKNLLHSKESSCDSSN
EYMDMKPGVSYVVPTKTDKRRSARIDSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKG
MAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIRNDSNYVVKGNARLPVKWMAPE
SIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAAM
YEVMKTCWDADPLKRPTFKQVVQLIEKQISDSSKHIYSNLANCNPNPENPVVVDHSVRVN
SVGSSTSSTQPLLVHEDA
NT seq 2937 nt   +upstreamnt  +downstreamnt
atgagaggcgctcgcggcgcctgggatctgctctgcgtcctgttggtcctgctccgtggc
cagacagggacttctcagccatctgcgagtccaggggagccgtctccaccatccatccag
ccggcccagtcagagttaatagttgaagccggcgacaccatcaggctgacgtgcactgac
cccgcctttgtcaaatggactttcgagatcctcgatgtaaggattgagaataagcagagc
gaatggattcgagaaaaagccgaggccactcacacgggcaaatacacgtgcgtcagcggc
agcggcctcaggagctctatttacgtgttcgttagagatcctgccgtacttttcctggtt
ggccttcccttgtttggcaaagaagacaatgacgcactggtccgctgccccctgacagac
ccacaggtgtccaattactccctcattgagtgtgatgggaaatctctccccacggacctg
aagttcgtccccaaccccaaggctggcatcaccatcaaaaacgtgaagcgcgcctaccac
cggctgtgcatccggtgtgctgcccagcgtgagggcaaatggatgcggtctgacaaattc
accctcaaagtgagggcagccatcaaagctatcccagtggtgtctgtgcccgaaacaagt
catctccttaaggaaggggacacatttacggtgatatgcaccataaaagacgtgtctaca
tccgtggactccatgtggataaagttgaaccctcagcctcagagcaaagcccaggtaaag
cgcaatagctggcatcagggcgacttcaattacgaacgccaggagacgctgactatcagc
tcagcaagagttaacgattccggagtgttcatgtgttatgccaataatacttttggatca
gcaaatgtcacaacaaccttgaaagtagtagaaaagggattcatcaacatcttccctgtg
aagaacactacggtatttgtaactgatggggaaaatgtagacttggttgttgagttcgag
gcctaccctaaacctgaacaccagcagtggatctacatgaacaggacgcctactaacaga
ggggaggattatgtcaaatccgacaaccaaagcaacatcagatatgtgaacgaacttcgc
ctgaccagattgaaaggcacagaaggaggcacttacacctttctggtgtccaactctgat
gtcagtgcttccgtgacatttgatgtttatgtgaacacaaaaccagaaatcctgacatat
gacaggctcatgaatggcaggctccagtgtgtggcggcgggattcccggagcccacaata
gattggtatttttgtacaggggcagagcaaaggtgtaccgttcctgtcccgccagtagac
gtacagatccagaatgcgtctgtgtcaccatttggaaaactggtggttcagagttccata
gactccagcgtcttccggcacaacggcacggtggagtgtaaggcctccaacgctgtgggc
aagagctctgccttctttaactttgcatttaaaggtaacagcaaagagcaaatccagccc
cacaccctgttcacgccgctgctcattggcttcgtggtcacagccggcttgatggggatc
attgtgatggttcttgcctacaaatatttgcagaaacccatgtatgaagtacaatggaag
gttgtcgaggagataaatgggaacaattatgtttacatagacccaacgcagcttccttat
gaccacaaatgggagtttcccagaaacaggctgagttttggaaagaccttgggagctggt
gcctttgggaaggtagttgaggccactgcctatggcttaattaagtcggatgccgccatg
acggttgccgtgaagatgctcaaaccaagtgcccatttaacggaaagggaggccctaatg
tcagaactgaaggtcctgagctacctgggtaatcacatgaatatcgtcaacctccttgga
gcgtgtaccgtgggagggcccaccctggtcattacagaatactgttgctatggtgatctt
ttgaatttcttgagaagaaagcgtgactcgtttattttctcaaagcaagaagaacaggca
gacgccgcactttataagaaccttctgcattcaaaggagtcttcctgtgacagctcaaac
gagtacatggacatgaagcctggcgtttcctacgtcgtaccaaccaagacagacaaaagg
agatccgcaagaatagactcgtatatagaaagagacgtgactcccgccatcatggaagat
gacgagctggctctggacctggaagatttgctgagcttttcctaccaggtggccaagggc
atggcgttcctcgcctccaagaactgtattcacagagatttggcagccaggaatatcctc
ctcactcacgggcggatcacaaagatttgcgatttcggcctagccagagacatcaggaat
gattcgaattacgtggtaaaaggaaatgcacggctgcccgtgaagtggatggcaccggag
agcattttcaactgcgtgtacacatttgaaagtgacgtctggtcctatgggattttcctc
tgggagctattctctctaggaagcagcccctacccagggatgccggtcgattccaagttt
tacaagatgatcaaggaaggtttccgaatgctcagccctgagcacgcgcctgccgcaatg
tatgaagttatgaagacttgctgggatgctgatcccctgaaaaggccaacattcaagcag
gttgttcagctcattgagaagcagatctcagacagcagcaaacatatttactccaactta
gcaaactgtaaccccaacccagagaaccccgtggtggtggaccattctgtgagggtcaat
tccgtcggcagcagcacctcttccacacagcctctccttgtgcatgaggacgcctga

KEGG   Rattus norvegicus (rat): 79114
Entry
79114             CDS       T01003                                 

Gene name
Fgfr1
Definition
(RefSeq) fibroblast growth factor receptor 1 precursor
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04520  Adherens junction
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04714  Thermogenesis
rno04810  Regulation of actin cytoskeleton
rno04928  Parathyroid hormone synthesis, secretion and action
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05215  Prostate cancer
rno05218  Melanoma
rno05224  Breast cancer
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    79114 (Fgfr1)
   04014 Ras signaling pathway
    79114 (Fgfr1)
   04015 Rap1 signaling pathway
    79114 (Fgfr1)
   04020 Calcium signaling pathway
    79114 (Fgfr1)
   04151 PI3K-Akt signaling pathway
    79114 (Fgfr1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    79114 (Fgfr1)
   04550 Signaling pathways regulating pluripotency of stem cells
    79114 (Fgfr1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    79114 (Fgfr1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    79114 (Fgfr1)
  09159 Environmental adaptation
   04714 Thermogenesis
    79114 (Fgfr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    79114 (Fgfr1)
   05205 Proteoglycans in cancer
    79114 (Fgfr1)
   05230 Central carbon metabolism in cancer
    79114 (Fgfr1)
  09162 Cancer: specific types
   05218 Melanoma
    79114 (Fgfr1)
   05215 Prostate cancer
    79114 (Fgfr1)
   05224 Breast cancer
    79114 (Fgfr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    79114 (Fgfr1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    79114 (Fgfr1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    79114 (Fgfr1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     79114 (Fgfr1)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   79114 (Fgfr1)
CD molecules [BR:rno04090]
 Proteins
  79114 (Fgfr1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   79114 (Fgfr1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Ig_5 C2-set_2 Ig_4 ABC1 Pkinase_fungal TCAD9 DUF1615 DUF4611
Other DBs
NCBI-GeneID: 79114
NCBI-ProteinID: NP_077060
RGD: 620713
Ensembl: ENSRNOG00000016050
UniProt: Q04589
Position
16
AA seq 822 aa
MWGWRGLLFWAVLVTATLCTARPAPTLPEQAQPWGVPVEVESLLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVRDSIPADSGLYACVTNSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPSPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYDQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIIYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPNPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWNAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQDSPSF
PDTRSSTCSSGEDSVFSHEPFPEEPCLPRHPTQLANGGLNRR
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgtggggctggaggggcctcctcttctgggctgtgctggtcacagccactctctgcact
gccagaccagccccaaccttgcccgaacaagctcagccctggggagtccctgtggaagtg
gagtctctcctggtccaccctggtgacctgctacagcttcgctgccggctgcgcgatgat
gtgcagagcatcaactggctgcgggatggggtgcagctggcggaaagcaaccgtacacgc
atcacaggggaggaggtggaggtgcgggattccatccccgctgactctggcctctacgct
tgtgtgaccaacagcccctctggcagcgataccacctacttctccgtcaatgtctcagat
gcactgccatcctcggaggacgatgacgatgatgatgactcctcctcagaggagaaagag
acagacaacaccaaaccaaaccgtaggcctgtggcgccatactggacatccccagagaaa
atggagaagaaactgcacgcagtgccagctgccaagacggtgaaattcaaatgcccgtcg
agtgggacacccagccccactttgcgctggttgaaaaacggcaaggaattcaaacctgac
caccggatcggaggctacaaggttcgttacgccacttggagcatcataatggactctgtg
gtgccttctgacaagggcaactacacctgcatcgtggagaacgagtatgggagcattaac
cacacctaccagctagacgttgtggagcgatcccctcaccggcccatccttcaggcaggg
ctaccagccaacaagaccgtggccctgggcagcaacgtggagttcatgtgcaaggtgtac
agtgacccccagcctcacatccagtggctgaagcacatcgaggtgaatgggagtaagatc
ggtccagacaacttgccgtatgaccagatcctgaagactgctggagttaataccaccgac
aaggaaatggaggtgcttcatctacggaatgtctcctttgaggatgcgggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaagagagaccagccgtgatgacctcacctctgtacctggaaatcattatctac
tgcaccggggccttcctgatctcctgtatggtgggctccgtcatcatctacaagatgaag
agcggcaccaagaagagcgacttccatagccagatggctgtgcataagctggctaagagc
atccctctccgcagacaggtaacagtgtcagctgactccagcgcatccatgaactccggg
gttctcctggttcggccttcgcgactgtcctccagcggaacccccatgctagctggcgtc
tctgaatatgagctccctgaagatccccgctgggagctgccccgggacagactggtctta
ggaaaaccgcttggcgagggctgcttcgggcaggtggtgttggccgaagccatcggtctg
gataaggacaaacccaaccgcgtgaccaaagtggccgtgaagatgttgaagtctgatgcg
acggagaaggacctgtcggacctgatctcggagatggagatgatgaaaatgatcgggaag
cacaagaatatcatcaacctgctgggggcgtgcacacaggatggtcctctctatgtcatt
gtggagtatgcctccaaaggcaatcttcgggagtatctgcaggcccggaggcctcctggg
ctggagtattgctacaaccccagccacaaccctgaggaacagctgtcttccaaagatctg
gtgtcctgtgcctatcaggtggcccggggcatggagtatcttgcctcgaagaagtgtata
caccgagacctggctgctaggaatgtcctggtgacagaggataatgtcatgaagatcgca
gactttggcctagctcgagacattcaccatatcgactactataagaaaaccaccaatggc
cggctgcctgtgaagtggatggcacctgaggcattgtttgaccggatctacacccaccag
agtgatgtgtggtcttttggggtgctcttatgggagatattcactctgggtggctcacca
aaccccggcgtgcctgtggaagaacttttcaagctgttgaaggagggtcatcgaatggac
aagcccagtaactgtaccaatgagctgtacatgatgatgcgggactgctggaacgcagtg
ccctctcagagaccaactttcaagcagttggtggaagacctggaccggattgtggccttg
acctccaaccaggagtatctggacctgtccatgccactggaccaggactcgccaagcttt
ccggacacacggagctctacctgctcttcaggggaggactctgtcttctctcatgagcca
tttcctgaggagccctgtctgccccgacaccccacccagcttgcaaatggcggactcaac
cggcgctga

KEGG   Rattus norvegicus (rat): 84489
Entry
84489             CDS       T01003                                 

Gene name
Fgfr3
Definition
(RefSeq) fibroblast growth factor receptor 3 precursor
  KO
K05094  fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04144  Endocytosis
rno04151  PI3K-Akt signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05219  Bladder cancer
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    84489 (Fgfr3)
   04014 Ras signaling pathway
    84489 (Fgfr3)
   04015 Rap1 signaling pathway
    84489 (Fgfr3)
   04020 Calcium signaling pathway
    84489 (Fgfr3)
   04151 PI3K-Akt signaling pathway
    84489 (Fgfr3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    84489 (Fgfr3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    84489 (Fgfr3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    84489 (Fgfr3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    84489 (Fgfr3)
   05206 MicroRNAs in cancer
    84489 (Fgfr3)
   05230 Central carbon metabolism in cancer
    84489 (Fgfr3)
  09162 Cancer: specific types
   05219 Bladder cancer
    84489 (Fgfr3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    84489 (Fgfr3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    84489 (Fgfr3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    84489 (Fgfr3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     84489 (Fgfr3)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   84489 (Fgfr3)
CD molecules [BR:rno04090]
 Proteins
  84489 (Fgfr3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set C2-set_2 ABC1 Pkinase_fungal TCAD9 RIO1
Other DBs
NCBI-GeneID: 84489
NCBI-ProteinID: NP_445881
RGD: 620714
Ensembl: ENSRNOG00000016818
UniProt: Q9JHX9
Position
14
AA seq 800 aa
MVVPACVLVFCVAVVAGVTSEPPGPEQRVGRRAAEVPGPEPSQQEQVAFGSGDTVELSCH
PPGGAPTGPTLWAKDGVGLVASHRILVGPQRLQVLNATHEDAGVYSCQQRLTRRVLCHFS
VRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSI
PWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVL
ERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYV
TVLKTAGANTTDRELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMEV
DEAGSVYAGVLSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKVSRFPLKRQVSLE
SNSSMNSNTPLVRIARLSSGEGPVLANVSELELPADPKWELSRTRLTLGKPLGEGCFGQV
VMAEAIGIDKDRTAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACT
QGGPLYVLVEYAAKGNLREFLRARRPPGMDYSFDACRLPEEQLTCKDLVSCAYQVARGME
YLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEAL
FDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMI
MRECWHAVPSQRPTFKQLVEDLDRILTVTSTDEYLDLSVPFEQYSPGGQDTPSSSSSGDD
SVFTHDLLPPGPPSNGGPRT
NT seq 2403 nt   +upstreamnt  +downstreamnt
atggtagtcccggcctgcgtgctagtgttctgcgtggcggtcgtggctggagttacttcc
gagcctcccggtccagagcagcgagttggtcggagagcggcagaggttccagggcctgaa
cctagccagcaggagcaggtggccttcggcagtggggacactgtggagctgagctgccat
ccgcctggaggtgcccccacaggccccactctctgggctaaggacggtgtggggctggtg
gcctcncaccgtatcctggtggggcctcagaggcttcaagtgctaaacgccacccatgag
gatgctggggtctacagctgccagcagcggctaacccggcgtgtgctgtgccactttagt
gtgcgtgtaacagatgctccgtcctcaggagatgacgaagatggggaggacgtggctgaa
gacacaggggctccttactggactcgaccggagcgtatggataagaaactgctggctgtg
ccagctgcaaacactgtacgcttccgctgcccagctgctggcaaccccaccccctccatc
ccctggctgaagaacggcaaagaattccgaggggagcaccgcattgggggcattaagctc
cggcaccagcagtggagcttggtcatggaaagtgtggtgccctctgaccgcggcaattac
acctgcgtggttgagaacaagtttggcagcatccggcagacgtacaccctggatgtgctg
gagcgctccccacaccggcccatcctgcaggctgggctgccagccaaccagacagccgtt
ctgggcagtgacgtggagttccactgcaaggtgtacagcgacgcacagccacacatccag
tggctgaagcacgtggaggtgaatgggagcaaggtgggccctgacggcacgccctacgtc
actgtactcaagactgcaggagctaacaccaccgacagggagctagaggttctgtccttg
cacaatgtcacctttgaggatgcgggggagtacacctgcctggcgggcaattctatcggg
ttttcccatcactctgcgtggctggtggtgctgccagccgaggaggagctgatggaagtt
gacgaggctggcagcgtgtacgcgggtgtcctcagctacggggtgggcttcttcctcttc
atcctggtggtggcggcagtgacgctctgccgtctgcgcagtcccccaaagaagggcctg
ggctcgcccaccgtgcacaaggtctctcgcttcccgcttaagcgacaggtgtccttggag
tctaattcctctatgaactccaacacacctctcgtccggattgcccggctgtcctcagga
gaaggtcctgtcctggccaatgtttctgaacttgagctgcctgctgaccccaagtgggag
ctatccaggacccggctgacactcggtaagcctcttggagaaggctgctttggacaggtt
gtcatggcagaagctattggcatcgacaaggaccgcactgccaagcctgtcaccgtggcc
gtgaagatgctgaaagatgatgcgactgacaaggacctgtcggacctggtgtctgagatg
gagatgatgaaaatgattggcaagcacaagaacatcattaacctgttgggggcctgcacc
cagggtgggcccctgtatgtgctggtggagtatgcagccaagggcaacctgcgagagttc
ctccgggcacggcggcctccaggcatggattactcctttgatgcctgcaggctgccagag
gaacagctcacctgcaaggatctggtgtcctgtgcctaccaggtggcacggggcatggag
tacttggcttcccagaagtgtattcacagagacctggctgccagaaacgtgctggtgact
gaggacaatgtgatgaagattgcagactttggcctggcccgagatgtgcacaacctggat
tactacaagaagaccacaaatggccggctacctgtgaagtggatggcaccagaggccctt
tttgaccgagtctacacccatcagagtgatgtctggtcctttggtgtcctcctctgggag
atctttacactgggtgggtcaccatatcctggcatcccagtggaagagcttttcaagctg
ttgaaagagggccaccgcatggacaagccagccaactgcacacatgacctgtacatgatc
atgcgggaatgttggcatgcagtgccttcacagaggcccaccttcaagcagttggtagag
gatttagaccgcatcctcacggtgacatcaactgacgagtacttggacctctcggtgcca
tttgaacagtactcgccaggtggccaagatactcctagctccagctcgtccggggacgac
tctgtgttcacccatgacctgctacccccaggcccacccagcaatgggggacctcggacg
tga

KEGG   Rattus norvegicus (rat): 89804
Entry
89804             CDS       T01003                                 

Gene name
Tek
Definition
(RefSeq) angiopoietin-1 receptor
  KO
K05121  endothelial-specific receptor tyrosine kinase [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04066  HIF-1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    89804 (Tek)
   04014 Ras signaling pathway
    89804 (Tek)
   04015 Rap1 signaling pathway
    89804 (Tek)
   04066 HIF-1 signaling pathway
    89804 (Tek)
   04151 PI3K-Akt signaling pathway
    89804 (Tek)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    89804 (Tek)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    89804 (Tek)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    89804 (Tek)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     89804 (Tek)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  TIE family
   89804 (Tek)
CD molecules [BR:rno04090]
 Proteins
  89804 (Tek)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_Tie2_1 Pkinase fn3 Pur_ac_phosph_N EGF_2 APH hEGF NDNF Pkinase_fungal DUF4702
Other DBs
NCBI-GeneID: 89804
NCBI-ProteinID: NP_001099207
RGD: 620980
Ensembl: ENSRNOG00000008587
UniProt: D3ZCD0
Position
5
AA seq 1120 aa
MDSLAGLVLCGVSLLLYGLVEGAMDLILINSLPLVSDAETSLTCIASGWHPHEPITIGRD
FEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGQAIRIRTMKMRQ
QASFLPATLTMTVDRGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPDCNRPCTTCKNNGVCHEDTGEC
ICPPGFMGRTCEKACEPHTFGRTCKERCSGSEGCKSYVFCLPDPYGCSCATGWRGLQCNE
ACPYGHYGPDCKLRCHCTNEEMCDRFQGCLCSQGWQGLQCEKEGRPRMTPQIEDLPDHIE
VNSGKFNPICKASGWPLPTSEEMTLVKPDGTVLQPNDFNHTDHFSVAIFTVNRILPPDSG
VWVCSVNTVAGMVEKPFNISVKVLPEPLHAPNVIDTGHNFAIINISSEPYFGDGPIKSKK
LFYKPVNQAWKYIQVMNEIVTLNYLEPRTDYELCVQLVRPGEGGEGHPGPVRRFTTASIG
LPPPRGLSLLPKSQTALNLTWQPIFTSSEDEFYVEVERWSQQTRSDQQNIKVPGNLTSVL
LNNLLPREQYSVRARVNTKAQGEWSEELRAWTLSDILPPQPENIKITNITDYTALVSWTI
VDGYSISSIIIRYKVQGKNEDQHIDVKIKNATITQYQLKGLEPETTYHVDIFAENNIGSS
NPAFSQEIRTLPAPKDLGGGKMLLIAILGSAGMTCITVLLAFLIMLQLKRANVQRRMAQA
FQNVREEPAVQFNSGTLALNRKAKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIK
KDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEY
APHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRD
LAARNILVGENYIAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSY
GVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPS
FAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA
NT seq 3363 nt   +upstreamnt  +downstreamnt
atggactctttagccggcttagttctctgtggagtcagcttgctcctttatggactagta
gaaggagccatggacctgatcttgatcaattccctacctcttgtgtctgatgccgaaaca
tccctcacctgcattgcttctgggtggcacccccacgagcccatcaccataggaagggac
tttgaagccttaatgaaccagcaccaagatccactggaagttactcaagatgtgaccaga
gaatgggcgaaaaaggttgtttggaagagagaaaaggccagtaagattaatggtgcttat
ttctgtgaaggtcgagttcgaggacaggctataaggatacgaaccatgaagatgcgtcaa
caagcttcctttctacctgctactctaactatgaccgtggacaggggagataatgtgaac
atatccttcaaaaaggtgttaattaaagaagaagatgcagtgatttacaaaaatggttcc
ttcattcattcagtgccccggcatgaagttcctgatattttagaagtgcatctgcctcac
gctcagccccaggatgctggtgtgtactcggccaggtacataggaggaaacctgttcacc
tcggccttcaccaggctgattgtccggagatgtgaagctcagaagtggggacccgactgt
aaccgtccttgtactacttgcaagaacaatggtgtctgccatgaagatactggggagtgc
atttgccctcctgggtttatggggaggacatgtgaaaaggcttgtgagccacacacattt
ggcaggacctgtaaggaacggtgtagtggatcagagggatgcaagtcatatgtgttctgt
ctgccagacccctatgggtgttcctgtgccacaggctggagggggctgcagtgcaatgaa
gcatgtccatacggtcactatgggccagactgtaagctcaggtgccactgtaccaatgaa
gagatgtgtgaccgcttccaaggatgcctctgctctcaaggatggcaagggctgcagtgt
gagaaagaaggcaggccaaggatgactccacagatagaggatttgccagatcacatagaa
gtaaacagtgggaaatttaacccgatctgcaaggcctctggctggccactacctactagt
gaagaaatgaccctggtgaagccggatgggacagtgctccaaccaaatgacttcaaccat
acagatcatttctcagtggccatattcactgtcaaccggatcttacctcctgactcagga
gtttgggtctgcagtgtgaacacagtggctgggatggtggaaaagcctttcaacatttct
gtcaaagttcttccagagcccctgcatgccccaaatgttattgacactggacacaacttt
gctatcatcaacatcagctctgagccttactttggggatggaccgatcaaatccaagaag
ctcttctataaacctgtcaatcaggcttggaaatacattcaagtgatgaatgagattgtc
acactcaactacctggagcctcggactgactacgagctgtgtgtacagctggtccgtcct
ggagagggtggagaaggacatcctggacctgtgagaagattcacaacagcgtctatcgga
ctccctcctccaagaggtctcagtctcctacccaaaagccagacagctctgaatttgact
tggcaaccgatatttacaagctcagaagatgaattttatgtggaagttgagaggtggtcc
cagcaaacaagaagtgatcagcagaacatcaaagtgcctgggaacctgacttccgtgctg
ctgaacaacttactccccagggagcagtacagcgtccgagctagagtcaacaccaaggcc
cagggggagtggagtgaagaactcagggcctggacccttagtgacattctccctcctcag
ccagaaaacatcaagatcaccaacatcactgattacacagctctggtttcttggacaatc
gtggacggctattcgatttcttccatcatcatccggtataaggttcagggcaaaaatgaa
gaccagcacattgacgtgaagatcaagaatgccaccatcactcaataccagctcaagggc
ctagagccagagactacataccatgtggatatttttgctgagaacaacataggatcaagc
aacccagccttttcccaagaaattaggacacttccagcccctaaagaccttggaggggga
aagatgctacttatagccattcttgggtcggctggaatgacttgcatcaccgtgctattg
gcgtttctgattatgttgcaactgaagagagcaaatgtccaaagaagaatggcccaggcc
ttccagaacgtgagagaagaaccagctgttcagttcaactcaggaactctggccctaaac
aggaaggccaaaaacaatccggatcccacaatttatcctgtgcttgactggaatgacatc
aagttccaagatgtgattggagagggcaactttggccaggttctgaaggcgcgcatcaag
aaggatgggttacggatggacgctgccatcaagaggatgaaagaatatgcctccaaagat
gatcacagggactttgcaggagaactggaggttctttgtaaacttggacaccatccgaac
atcattaatctcttgggagcatgtgaacacagaggctacttatacctggctattgagtat
gccccacatggaaacctcctggactttctgcgtaagagccgagtgctagagacagaccct
gcctttgccatcgccaacagcacggcttccacactgtcctcccagcagcttcttcatttt
gctgcagatgtggcccgggggatggactacttgagccaaaaacagtttatccacagggac
ctggctgccagaaacattttagttggcgaaaactacatagccaaaatagcagattttgga
ttgtcacgaggtcaagaagtgtatgtgaaaaagacaatgggaaggctcccagtgcgctgg
atggcaattgagtctctgaactatagtgtctatacaaccaacagtgatgtatggtcctat
ggtgtattgctctgggagatcgttagcttaggaggcactccatactgcggcatgacatgt
gcagaactctatgagaagctgccccagggctacagattggagaagcccctgaactgtgat
gatgaggtgtatgatctaatgagacaatgctggagggagaagccttatgagagaccatca
tttgcccagatattggtgtccttaaacagaatgctggaagaacgaaagacatacgtgaac
accacactttatgagaagtttacctacgcaggaattgactgttctgctgaagaagcagcc
tag

DBGET integrated database retrieval system