KEGG   Rattus norvegicus (rat): 114114
Entry
114114            CDS       T01003                                 

Gene name
Dnm1l, DLP1, Dnml1, Drp1
Definition
(RefSeq) dynamin 1-like
  KO
K17065  dynamin 1-like protein [EC:3.6.5.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04621  NOD-like receptor signaling pathway
rno04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    114114 (Dnm1l)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    114114 (Dnm1l)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114114 (Dnm1l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    114114 (Dnm1l)
   03029 Mitochondrial biogenesis [BR:rno03029]
    114114 (Dnm1l)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    114114 (Dnm1l)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     114114 (Dnm1l)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    114114 (Dnm1l)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    114114 (Dnm1l)
   RhoA-dependent endocytosis
    114114 (Dnm1l)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    114114 (Dnm1l)
   Retention of mitochondria
    114114 (Dnm1l)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114114 (Dnm1l)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_16 FtsK_SpoIIIE AAA_28
Other DBs
NCBI-GeneID: 114114
NCBI-ProteinID: NP_446107
RGD: 620416
Ensembl: ENSRNOG00000001813
UniProt: O35303
Position
11q23
AA seq 716 aa
MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTR
RPLILQLVHVSPEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISG
NNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSI
ILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLG
IIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDC
LPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSEL
CGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQ
IKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTN
EMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKLIQDNRRE
TKNVASAGGGIGDGGRIGDGGQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKG
HAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKD
TLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW
NT seq 2151 nt   +upstreamnt  +downstreamnt
atggaggcgctgatcccggtcatcaataagctgcaagacgtcttcaacaccgtgggcgcc
gacatcatccagctgcctcagattgtcgtagtgggaactcagagcagtggaaagagctca
gtgctggaaagcctagtggggagggaccttcttcccagagggactggtgtggtcacccgg
agacctcttattctgcagctggtccacgtttcaccagaagataaaagaaaaacaacagga
gaagaaaatggagttgaagcagaagaatggggtaaatttcttcacaccaaaaacaagctt
tacacagattttgatgaaattcgacaagaaattgaaaatgaaactgaaagaatttcagga
aataataagggagtaagccctgagccaatccatctcaaggttttctcgcccaacgttgtc
aacctgacgcttgtggatttaccaggaatgaccaaagtacctgtaggtgatcagcccaag
gatattgagcttcaaatcagagaacttattcttcggttcatcagtaatcccaattccatt
atccttgctgtcactgctgcaaatacagatatggcaacgtcagaggcacttaagatttcc
agagaggtagatccagatgggcgcagaactctagctgtaatcaccaagcttgatctcatg
gatgcgggtactgatgccatggatgtattgatgggaagggttattccagtcaagcttgga
ataattggagtagttaacaggagccaactggacattaacaataagaagagtgtaactgat
tcaatccgtgatgagtatgcttttcttcaaaagaagtacccatctctggccaacagaaat
ggaacaaagtatcttgctaggactctgaataggttacttatgcatcatatcagagactgt
ttaccagagctgaaaacaagaataaatgtcttagctgctcagtatcagtctcttctaaat
agctatggtgagcccgtggatgataaaagtgctactttactccagctcattaccaagttt
gccacagagtattgtaacactattgaaggaacggcaaagtacattgaaacttctgagcta
tgtggtggtgctaggatttgttatattttccatgagacttttgggcgaaccttagaatct
gttgatccactaggtggccttaacactattgacatcttgaccgccattagaaatgctact
ggcccccgtccagctttatttgtgcctgaagtttcatttgagttactggtcaaacgtcag
attaagcgtctagaggagcccagcctccgctgtgtggagctggtccacgaggaaatgcag
aggatcattcagcactgtagcaactacagcacacaggaactgttacggttccctaaactc
catgatgccatagttgaagtagtgacttgtcttcttcgtaaaaggttgcccgtgacaaat
gaaatggtacataacttagtggcaattgagctagcatatatcaacacaaaacaccccgac
tttgctgatgcctgtgggctaatgaacaataacatagaggaacaaagaagaaacagacta
gcaagagaactaccttccgctgtatcgcgagacaagttaattcaggacaacagaagagaa
actaaaaatgttgcatctgcaggtggtggaattggagatggtggtcgaattggagatggt
ggtcaggaaccgacaacaggcaactggagaggaatgctgaaaacttcaaaagctgaagaa
ttacttgctgaagaaaaatcaaaaccaattccaattatgccagcaagtccacaaaaaggc
catgctgtcaatttgctagatgtgccagttccagttgcacgaaaactgtctgcccgagaa
cagcgagattgtgaggttattgaaagactcatcaaatcatattttctaattgtcagaaag
aatattcaagacagcgtcccaaaggcagtaatgcattttttggttaatcatgtgaaagat
actcttcagagtgaattagtagggcagctgtataagtcatccttattagatgaccttctg
actgaatccgaggacatggcacagcgaagaaaagaagcggctgacatgctgaaggcatta
caaggagccagtcaaattattgctgaaatccgagagactcatctttggtga

DBGET integrated database retrieval system