KEGG   Rattus norvegicus (rat): 114118
Entry
114118            CDS       T01003                                 

Gene name
Gng4
Definition
(RefSeq) G protein subunit gamma 4
  KO
K04541  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04062  Chemokine signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04371  Apelin signaling pathway
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04926  Relaxin signaling pathway
rno05032  Morphine addiction
rno05034  Alcoholism
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    114118 (Gng4)
   04371 Apelin signaling pathway
    114118 (Gng4)
   04151 PI3K-Akt signaling pathway
    114118 (Gng4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    114118 (Gng4)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    114118 (Gng4)
  09156 Nervous system
   04724 Glutamatergic synapse
    114118 (Gng4)
   04727 GABAergic synapse
    114118 (Gng4)
   04725 Cholinergic synapse
    114118 (Gng4)
   04728 Dopaminergic synapse
    114118 (Gng4)
   04726 Serotonergic synapse
    114118 (Gng4)
   04723 Retrograde endocannabinoid signaling
    114118 (Gng4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    114118 (Gng4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114118 (Gng4)
  09165 Substance dependence
   05032 Morphine addiction
    114118 (Gng4)
   05034 Alcoholism
    114118 (Gng4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    114118 (Gng4)
   05163 Human cytomegalovirus infection
    114118 (Gng4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    114118 (Gng4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    114118 (Gng4)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    114118 (Gng4)
SSDB
Motif
Pfam: G-gamma ATP-synt_F
Other DBs
NCBI-GeneID: 114118
NCBI-ProteinID: XP_001053747
RGD: 620806
Ensembl: ENSRNOG00000047080
UniProt: M0R809
Position
17q12.3
AA seq 75 aa
MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAASDLLAYCEAHVREDPLIIPVPA
SENPFREKKFFCTIL
NT seq 228 nt   +upstreamnt  +downstreamnt
atgaaggaaggcatgtctaataacagcaccaccagcatctcccaggccaggaaagctgta
gagcagctgaagatggaagcctgcatggacagggtgaaggtctcccaggctgcctcggac
ctcctggcctactgtgaagcccacgtgcgggaggatcctctcatcatccctgtgcctgcc
tcagaaaaccccttccgggagaagaagttcttctgcaccattctttaa

DBGET integrated database retrieval system