KEGG   Rattus norvegicus (rat): 114125
Entry
114125            CDS       T01003                                 

Gene name
Dll3
Definition
(RefSeq) delta like canonical Notch ligand 3
  KO
K06051  delta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04330  Notch signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno05200  Pathways in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    114125 (Dll3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    114125 (Dll3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114125 (Dll3)
  09162 Cancer: specific types
   05224 Breast cancer
    114125 (Dll3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    114125 (Dll3)
SSDB
Motif
Pfam: EGF hEGF EGF_2 EGF_CA DSL
Other DBs
NCBI-GeneID: 114125
NCBI-ProteinID: NP_446118
RGD: 70953
Ensembl: ENSRNOG00000019338
Vega: OTTRNOG00000001219
UniProt: O88671
Position
1q21
AA seq 589 aa
MVSLQVSSLPQTLILAFLLPQALPAGVFELQIHSFGPGPGPGTPRSPCNARGPCRLFFRV
CLKPGVSQEAAESLCALGAALSTSGPVYTEQPGVPAAALSLPDGLVRVPFLDAWPGTFSL
IIETWREQLGERAAGPAWNLLARVAGRRRLAAGAPWARDVQRTGAWELHFSYRARCEPPA
VGAACARLCRSRSAPSRCGPGLRPCTPFPDECEAPRESLTVCRAGCSPEHGYCEEPDECH
CLEGWTGPLCTVPVSTSSCLNSRVSGPAGTGCLLPGPGPCDGNPCANGGSCSETPGSFEC
ACPRGFYGPRCEVSGVTCADGPCFNGGLCVGGEDPDSAYVCHCPPAFQGSNCERRVDRCS
LQPCQNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGARRCSCA
LGFGGRDCRERADPCASRPCAHGGRCYAHFSGLVCACAPGYMGVRCEFAVRPDGADAVPA
APRGLRQADSQRFLLPPALGLLAAAALAGAALLLIHVRRRGPGRDTGTRLLSGTREPSVH
TLPDALNNLRLQDGAGDGPTSSADWNHPEDGDSRSIYVIPAPSIYAREA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggtctccctgcaggtgtcttcacttccccagacgctgatcctggcttttctccttccc
caggcactgccagctggtgtcttcgagctacaaattcattctttcgggccaggaccaggc
cccgggaccccacgctccccctgcaacgcccgaggcccttgccgcctcttcttcagggtc
tgcctgaaaccgggagtctcccaggaggccgccgagtccctgtgcgccctgggcgcagca
ctgagcacgagcggcccggtctacacggagcagcctggagtgccagcggctgccttgtcg
ttgcctgatggcctcgtgcgtgtgcctttcctcgatgcctggccgggcaccttttccctc
attattgaaacctggagagagcagctgggagagcgtgctgcagggcccgcctggaaccta
ttagcgcgtgtggccggtcgcagacgcctggctgctggagccccgtgggcccgcgatgtg
cagcgcacaggcgcatgggagttgcacttctcataccgcgcgcgctgtgagccccctgcg
gttggggccgcctgcgcgcgcctgtgccgctcgcgcagcgccccctcgcggtgtggccca
ggactgcgcccctgcacgccattcccagacgagtgtgaagccccgcgtgagtccctaacc
gtatgtcgagcgggctgcagccctgagcacggctactgtgaagaacctgacgaatgccat
tgcctggagggctggactggacccctctgcacggtccctgtctccaccagcagctgcctg
aactcccgggtctctggtcctgccggcactggatgccttttacctgggcctggaccctgt
gatgggaacccatgtgccaatgggggcagctgtagtgaaaccccgggctcctttgaatgt
gcctgtccccggggattctatgggcctcgatgtgaggtgagcggggtgacatgcgcagat
ggaccctgcttcaatggcggcttgtgtgttggcggtgaagatcctgactctgcctatgtc
tgtcactgcccacctgctttccaaggctctaactgtgagaggagggtggaccgctgtagc
ctgcagccttgtcagaatggcggcctctgccttgacctgggacatgcgctgcgctgccgc
tgtcgcgcgggattcgccgggccacgctgcgagcacgacctggacgactgcgccggccgc
gcctgtgccaacggcggcacgtgcgtggagggcggcggcgcgcgccgctgctcgtgtgcg
ctgggcttcggcgggcgcgactgtcgggaacgcgcggacccctgcgcctctcgcccctgc
gcccatggaggccgttgctacgcccacttctccggccttgtctgcgcctgcgcgcccggc
tacatgggtgtgagatgcgagttcgctgtgcgccccgacggggcggacgccgtgcccgcg
gctccgcggggcctgaggcaggctgactcacagcgcttccttctgcctcccgccttgggg
ctgctggcggccgcagctttggccggggccgctctcttgctcatccacgttcgccgccga
ggtcctggccgggatactgggactcgcctgctttccgggacccgggagccttcggtccac
acgctcccggatgcactcaacaacctgaggttacaagacggtgctggggatggccccacg
tcgtcggctgactggaatcatcccgaagatggggactctcgatctatttatgtcatacca
gccccttccatttacgcacgagaggcctga

DBGET integrated database retrieval system