KEGG   Rattus norvegicus (rat): 114125
Entry
114125            CDS       T01003                                 

Gene name
Dll3
Definition
(RefSeq) delta-like protein 3 precursor
  KO
K06051  delta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04330  Notch signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno05200  Pathways in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    114125 (Dll3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    114125 (Dll3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114125 (Dll3)
  09162 Cancer: specific types
   05224 Breast cancer
    114125 (Dll3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    114125 (Dll3)
SSDB
Motif
Pfam: EGF hEGF EGF_2 EGF_CA EGF_3 DSL
Other DBs
NCBI-GeneID: 114125
NCBI-ProteinID: NP_446118
RGD: 70953
Ensembl: ENSRNOG00000019338
Vega: OTTRNOG00000001219
UniProt: O88671
Position
1
AA seq 589 aa
MVSLQVSSLPQTLILAFLLPQALPAGVFELQIHSFGPGPGPGTPRSPCNARGPCRLFFRV
CLKPGVSQEAAESLCALGAALSTSGPVYTEQPGVPAAALSLPDGLVRVPFRDAWPGTFSL
IIETWREQLGERAAGPAWNLLARVAGRRRLAAGAPWARDVQRTGAWELHFSYRARCEPPA
VGAACARLCRSRSAPSRCGPGLRPCTPFPDECEAPRESLTVCRAGCSPEHGYCEEPDECH
CLEGWTGPLCTVPVSTSSCLNSRVSGPAGTGCLLPGPGPCDGNPCANGGSCSETPGSFEC
ACPRGFYGPRCEVSGVTCADGPCFNGGLCVGGEDPDSAYVCHCPPAFQGSNCERRVDRCS
LQPCQNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGARRCSCA
LGFGGRDCRERADPCASRPCAHGGRCYAHFSGLVCACAPGYMGVRCEFAVRPDGADAVPA
APRGLRQADSQRFLLPPALGLLAAAALAGAALLLIHVRRRGPGRDTGTRLLSGTREPSVH
TLPDALNNLRLQDGAGDGPSSSADWNHPEDGDSRSIYVIPAPSIYAREA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggtctccctgcaggtgtcttcacttccccagacgctgatcctggcttttctccttccc
caggcactgccagctggtgtcttcgagctacaaattcattctttcgggccaggaccaggc
cccgggaccccacgctccccctgcaacgcccgaggcccttgccgcctcttcttcagggtc
tgcctgaaaccgggagtctcccaggaggccgccgagtccctgtgcgccctgggcgcagca
ctgagcacgagcggcccggtctacacggagcagcctggagtgccagcggctgccttgtcg
ttgcctgatggcctcgtgcgtgtgcctttccgcgatgcctggccgggcaccttttccctc
atcattgaaacctggagagagcagctgggagagcgtgctgcagggcccgcctggaaccta
ttagcgcgtgtggccggtcgcagacgcctggctgctggagccccgtgggcccgcgatgtg
cagcgcacaggcgcatgggagttgcacttctcataccgcgcgcgctgtgagccccctgcg
gttggggccgcctgcgcgcgcctgtgccgctcgcgcagcgccccctcgcggtgtggccca
ggactgcgcccctgcacgccattcccagacgagtgtgaagccccgcgtgagtccctaacc
gtatgtcgagcgggctgcagccctgagcacggctactgtgaagaacctgacgaatgccat
tgcctggagggctggactggacccctctgcacggtccctgtctccaccagcagctgcctg
aactcccgggtctctggtcctgccggcactggatgccttttacctgggcctggaccctgt
gatgggaacccatgtgccaatgggggcagctgtagtgaaaccccgggctcctttgaatgt
gcctgtccccggggattctatgggcctcgatgtgaggtgagcggggtgacatgcgcagat
ggaccctgcttcaatggcggcttgtgtgttggcggtgaagatcctgactctgcctatgtc
tgtcactgcccacctgctttccaaggctctaactgtgagaggagggtggaccgctgtagc
ctgcagccttgtcagaatggcggcctctgccttgacctgggacatgcgctgcgctgccgc
tgtcgcgcgggattcgccgggccacgctgcgagcacgacctggacgactgcgccggccgc
gcctgtgccaacggcggcacgtgcgtggagggcggcggcgcgcgccgctgctcgtgtgcg
ctgggcttcggcgggcgcgactgtcgggaacgcgcggacccctgcgcctctcgcccctgc
gcccatggaggccgttgctacgcccacttctccggccttgtctgcgcctgcgcgcccggc
tacatgggtgtgagatgcgagttcgctgtgcgccccgacggcgcggacgccgtgcccgcg
gctccgcggggcctgaggcaggctgactcacagcgcttccttctgcctcccgccttgggg
ctgctggcggccgcagctttggccggcgccgctctcttgctcatccacgttcgccgccga
ggtcctggccgggatactgggactcgcctgctttccgggacccgggagccttcggtccac
acgctcccggatgcactcaacaacctgaggttacaagacggtgctggggatggccccagc
tcgtcggctgactggaatcatcccgaagatggggactctcgatctatttatgtcatacca
gccccttccatttacgcacgagaggcctga

KEGG   Rattus norvegicus (rat): 311332
Entry
311332            CDS       T01003                                 

Gene name
Dll4
Definition
(RefSeq) delta-like protein 4 precursor
  KO
K06051  delta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04330  Notch signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno05200  Pathways in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    311332 (Dll4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    311332 (Dll4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    311332 (Dll4)
  09162 Cancer: specific types
   05224 Breast cancer
    311332 (Dll4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    311332 (Dll4)
SSDB
Motif
Pfam: EGF DSL hEGF MNNL EGF_2 DUF4381 LYRIC
Other DBs
NCBI-GeneID: 311332
NCBI-ProteinID: NP_001101230
RGD: 1309740
Ensembl: ENSRNOG00000014011
Structure
PDB: 
4XL1 4XLW

Position
3
AA seq 685 aa
MTPGSRSACRWALLLLAVLWPQRAAGSGIFQLRLQEFANERGMLANGRPCEPGCRTFFRI
CLKHYQATFSEGPCTFGNVSTPVLGTNSFVIRDKNSGSGRNPLQLPFNFTWPGTFSLNIQ
AWHTPGDDLRPETSPGNSLISQIIIQGSLAVGKNWKSDEQNNTLTRLRYSYRVVCSDNYY
GDSCSRLCKKRDDHFGHYECQPDGSLSCLPGWTGKYCDQPICLSGCHEQNGYCSKPDECN
CRPGWQGPLCNECIPHNGCRHGTCTIPWQCACDEGWGGLFCDQDLNYCTHHSPCKNGSTC
SNSGPRGYTCTCLPGYTGEHCELELSKCASNPCRNGGSCKDHENSYHCLCPPGYYGQHCE
HSTLTCADSPCFNGGSCRERNQGASYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNR
GPSRTCRCRPGFTGTHCELHISDCARSPCAHGGTCHDLENGPVCTCPAGFSGRRCEVRIT
NDACASGPCFNGATCYTGLSPNNFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLVV
LLVLLVMVAVAVRQLRLRRPDDDSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGL
DKSNCGKLQNHTLDYNLAPGFLGRGSTPGKYPHSDKSLGEKVPLRLHSEKPACRISAICS
PRDSMYQSVCLISEERNECVIATEV
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgacgcctgggtcccggagcgcctgtcgctgggcgctactgctgctggcggtcctgtgg
ccgcagcgcgcggcgggctccggcatcttccagttgcggctgcaggagttcgccaacgag
cgcggtatgctggccaatgggcggccctgcgagcccggctgccggactttcttccgaatc
tgccttaagcattaccaggcaaccttctccgagggaccctgcacctttggcaatgtctcc
acgccggtattgggcaccaactccttcgtcatcagggacaagaatagcggcagtggtcgt
aaccctcttcaattgcccttcaattttacctggccgggaaccttctcactcaacatccaa
gcttggcacacgccgggagacgacctgcggccagagacttcaccaggaaattcacttatc
agccaaatcatcatccaaggctcccttgctgtgggtaagaattggaaatcagatgagcaa
aataacaccctcacaagactgcgctactcttaccgggtcgtctgcagcgacaactactat
ggagatagctgttctcgcctgtgcaagaagcgcgatgaccacttcggacattatgagtgc
caaccagatggcagcctgtcctgcctgccgggctggactgggaaatactgtgatcagcct
atatgtctttctggctgtcatgagcagaatggctactgcagcaagccagatgagtgcaac
tgccgtccaggttggcagggccccttatgcaatgaatgtatcccccacaatggctgtcgt
catggcacctgcaccatcccctggcaatgtgcctgcgatgagggctggggaggtctgttt
tgtgaccaagatcttaattactgcactcaccactctccgtgcaagaatggatcaacttgc
tccaacagtgggccgaggggctatacctgcacctgtctcccaggctacactggtgagcac
tgtgagctggaactcagcaagtgtgccagcaacccctgtcgaaatggtggcagctgtaag
gaccatgagaatagctaccactgcctgtgtcccccgggctactatggccagcactgtgaa
cacagtaccttgacctgtgcggattcaccctgcttcaatggaggctcctgccgggagcgc
aaccagggggccagttatgcctgcgagtgtccccctaacttcactgggtccaactgtgag
aagaaagttgacaggtgtaccagcaacccctgtgccaatggaggtcagtgcctgaacaga
ggtccaagccggacctgccgctgtcgacctggattcacaggcacccactgtgaactgcac
atcagcgattgtgcccgaagcccttgtgcccatgggggcacttgccacgatctggagaac
gggcctgtgtgcacctgccctgctggcttttctggcaggcgctgcgaggtgcggataacc
aacgacgcctgtgcctcaggaccctgcttcaatggggccacttgctacactggcctctcc
ccaaacaactttgtctgcaactgtccttatggctttgtgggcagccgctgcgagtttccc
gtgggcttgccacccagcttcccctgggtagctgtctccctgggtgtggggctggtggta
ctgctggtgttgctggtcatggtggcagtggctgtgcggcagctgcggcttcggaggccc
gatgacgacagcagggaagccatgaacaatttgtcagacttccagaaggacaacctaatc
cctgctgcccagctcaagaacacaaaccagaagaaggagctggaagtggattgtggcctg
gacaagtccaactgtggcaaactgcagaaccacacactggactataatctggccccagga
ttcctggggcgggggagcacgcctgggaagtatcctcacagcgacaagagtttaggagag
aaggtgccacttcggttacacagtgaaaagccggcatgtcgaatatcagcgatatgctcc
cccagggactctatgtaccagtcagtatgtttgatatcagaagagaggaacgaatgtgtc
attgccacagaggtataa

KEGG   Rattus norvegicus (rat): 84010
Entry
84010             CDS       T01003                                 

Gene name
Dll1
Definition
(RefSeq) delta-like protein 1 precursor
  KO
K06051  delta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04330  Notch signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno05200  Pathways in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    84010 (Dll1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    84010 (Dll1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    84010 (Dll1)
  09162 Cancer: specific types
   05224 Breast cancer
    84010 (Dll1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    84010 (Dll1)
SSDB
Motif
Pfam: EGF hEGF MNNL DSL EGF_CA EGF_3 cEGF EGF_2 ECSCR
Other DBs
NCBI-GeneID: 84010
NCBI-ProteinID: NP_114452
RGD: 70949
Ensembl: ENSRNOG00000059984
UniProt: P97677
Position
1
AA seq 714 aa
MGRRSALALAVVSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGSGPPCACRTFFR
VCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGAGIDPAFSNPIRFPFGFTWPGTFS
LIIEALHTDSPDDLATENPERLISRLTTQRHLTVGEEWSQDLHSSGRTDLRYSYRFVCDE
HYYGEGCSVFCRPRDDAFGHFTCGERGEKMCDPGWKGQYCTDPICLPGCDDQHGYCDKPG
ECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCRNG
ATCTNTGQGSYTCSCRPGYTGANCELEVDECAPSPCRNGGSCTDLEDSYSCTCPPGFYGK
VCELSAMTCADGPCFNGGRCSDNPDGGYTCHCPAGFSGFNCEKKIDLCSSSPCSNGAKCV
DLGNSYLCRCQTGFSGRYCEDNVDDCASSPCANGGTCRDSVNDFSCTCPPGYTGRNCSAP
VSRCEHAPCHNGATCHQRGQRYMCECAQGYGGANCQFLLPEPPPDLIVAAQGGSFPWVAV
CAGVVLVLLLLLGCAAVVVCVRLKLQKHQPPPDPCGGETETMNNLANCQREKDVSVSIIG
ATQIKNTNKKADFHGDHGADKSSFKARYPTVDYNLIRDLKGDEATVRDAHSKRDTKCQSQ
GSVGEEKSTSTLRGGEVPDRKRPESVYSTSKDTKYQSVYVLSAEKDECVIATEV
NT seq 2145 nt   +upstreamnt  +downstreamnt
atgggccgtcggagcgcgctagcccttgccgtggtctcagccctgctgtgccaggtctgg
agctctggcgtatttgagctgaagctgcaggagttcgtcaacaagaaggggctgctgggg
aaccgcaactgctgccgcgggggctctggcccgccgtgcgcctgcaggaccttctttcgc
gtatgcctcaagcattaccaggccagcgtgtccccggagccaccctgcacctacggcagt
gcggtcacgccagtgctgggtgtcgactccttcagcctgcctgatggcgcaggcatcgac
cccgccttcagcaaccccatccgattccccttcggattcacctggccaggtaccttctct
ctgatcattgaagccctccacacagattctcctgacgacctcgcaacagaaaacccagaa
agactcatcagccgcctgaccacacagaggcacctcactgtgggagaagagtggtctcag
gaccttcacagtagcggccgcacagacctccgctactcttaccggtttgtgtgtgatgaa
cactactatggagaaggctgctccgtgttctgccgaccgcgggatgatgcctttggccac
ttcacctgcggggagagaggggagaagatgtgcgaccctggctggaaaggccagtactgc
actgaccccatttgtctgccaggctgtgatgaccaacatggatattgtgacaaaccgggg
gaatgcaagtgcagagttggctggcagggccgctactgcgatgaatgcatccgataccca
ggctgtctccatggtacctgccagcagccctggcagtgtaactgccaggaaggctggggg
ggcctcttctgcaaccaggatctgaactactgcactcaccataagccatgcaggaacgga
gccacctgcaccaacacgggccaggggagctacacatgctcttgccgacccgggtataca
ggggccaactgtgagctggaggtagatgagtgtgctcccagcccctgcaggaatggaggg
agctgcacggatcttgaggacagctactcttgcacctgccctcctggcttctatggcaag
gtctgtgagctgagcgccatgacgtgtgcagatggtccttgcttcaatgggggacgatgt
tcggataaccccgatggaggctacacctgccattgccctgcgggcttctctggcttcaac
tgtgagaagaagattgatctctgtagctcttccccttgttctaacggtgccaagtgtgtg
gacctcggcaactcctacctgtgccgatgtcagactggcttctccgggaggtactgcgag
gacaatgtggatgactgtgcctcttctccctgtgcaaacgggggcacctgccgggacagt
gtgaacgatttctcctgtacctgcccacctggctacacaggcaggaactgcagcgcccct
gtcagcaggtgtgagcatgcaccctgtcataacggggccacctgccaccagaggggccaa
cgctacatgtgtgagtgcgcccagggctatggcggcgccaactgccagttcctgctccct
gagccaccaccagacctcatagtggcggcccagggcgggtccttcccctgggtggctgtg
tgtgccggggtggtgcttgtcctcctgctgctgctgggctgtgctgctgtggtggtctgc
gtccggctgaagctacagaaacaccagcctccgcctgatccttgcgggggagagacagag
accatgaacaacctagccaattgccagcgtgagaaggatgtttctgttagcatcattggg
gctacacagatcaagaacaccaacaagaaggcggactttcatggggaccatggtgctgac
aagagcagctttaaggcccgataccccactgtggactataacctcattcgagacctcaag
ggagatgaagccacggtcagggatgcacacagcaaacgtgacaccaagtgccagtcacag
ggctctgtaggagaagagaagagcacctcaacgctcaggggtggggaggttcccgacaga
aaaaggcccgaatctgtctactctacttcaaaggacaccaagtaccagtcggtgtatgtt
ctatctgcagaaaaggatgagtgtgttatagcgactgaggtttaa

DBGET integrated database retrieval system