KEGG   Rattus norvegicus (rat): 114203
Entry
114203            CDS       T01003                                 

Gene name
Sh2b2, Aps
Definition
(RefSeq) SH2B adaptor protein 2
  KO
K07193  SH2B adapter protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04722  Neurotrophin signaling pathway
rno04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114203 (Sh2b2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    114203 (Sh2b2)
SSDB
Motif
Pfam: Phe_ZIP PH SH2
Other DBs
NCBI-GeneID: 114203
NCBI-ProteinID: NP_446121
RGD: 69284
Ensembl: ENSRNOG00000001425
UniProt: Q9Z200
Structure
PDB: 
1RPY 1RQQ

Position
12q12
AA seq 621 aa
MNGATPGSAAAPAPVPDWRQFCELHAQVAAVDFAHKFCRFLRDNPTYDTPDAGTSFSRHF
AANFLAVFSEEVRRVLGTAADTMEPEPAVTSVTSALKTATYGHSRSSEDVSAHVATKARV
RKGFSLRNMSLCVVDGVRDLWHRRASPEPEGGATPKTTEPVSEPRDKWTRRLRLARTLAA
KVELVDIQREGALRFMVADDAASGPGGTAQWQKCRLLLRRAVAGERFRLEFFVPPKASRP
KVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVDP
GDSEEDTGLSCARGGCLASRVTSCSCELLTEADMPRPPETMTAVGAVVTAPHGRARDTVG
ESLAHVPLETFLQTLESSGGVSESNNTGDEGAELDPDAEAELELSDYPWFHGTLSRVKAA
QLVLAGGPRSHGLFVIRQSETRPGECVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVF
DMLRHFHTHPIPLESGGSADITLRSYVRAQGPPPDPGPAPNTAAPVPACWTEPAGQHYFS
SLATATCPPTSPSNGAGASSSSGSSSSATSVPPRPAEGPLSARSRSNSTEHLLEAASGAT
EEPADATLGRARAVENQYSFY
NT seq 1866 nt   +upstreamnt  +downstreamnt
atgaatggtgccacccccggctcggcagccgcccccgccccagtccccgactggaggcaa
ttctgcgagctgcacgctcaggtagctgctgtggacttcgctcacaagttctgccgcttc
cttcgggacaacccgacctacgacacgcctgacgctgggacctcgttctcccgccacttt
gcagccaacttcttggcagtcttcagcgaggaagtgcgccgcgtgctggggacagcagct
gacaccatggaacccgagcctgcggtgacctccgtgacctcggcgctcaagactgcaacc
tatggccactctcgcagctccgaagatgtgtctgctcacgtggctaccaaggcccgtgtc
cgcaaaggcttctcactgcgtaacatgagcctgtgtgtagtggacggagtgcgcgaccta
tggcaccggcgcgcatccccagagcccgagggtggggccaccccgaaaaccaccgagcct
gtgtccgagcctcgtgacaaatggacgcgacgtctgcggctggcacgaaccctggcagcc
aaagtggagttagtggacatccagcgcgagggcgcactgcgcttcatggtggcagatgat
gcagcctccggccctgggggcacggcacagtggcagaaatgtcgcctgctcctccgaagg
gctgtggccggagagcgcttccgcctggagttcttcgtgccacccaaggcttccagaccc
aaggtcagcatccccctgtcggccatcatcgaggtccgaaccaccatgcccctggaaatg
cctgagaaggacaacacatttgtgctcaaggtggagaacggagcggagtacattctggag
acgatagactcactacagaagcactcgtgggtggctgacatccagggctgtgtggatcct
ggggacagtgaggaagacacagggctgtcttgtgcacggggaggctgtctggccagccgc
gtgacctcctgcagctgtgagctcctgacagaagcagacatgccccggcccccagagacg
atgacagcagtgggtgctgtggttacagctccacatggccgagctcgtgacaccgtggga
gagtccctggctcacgttcccctggagactttcctgcaaaccctggagtcttcaggtggt
gtcagtgagagcaataacacaggggatgaaggagctgagctggaccccgatgctgaggct
gagctggaactctccgactacccctggttccatgggacactgtcccgggtgaaggccgcc
cagctggtgttggctggtgggccccggagtcacggcctctttgtgatccgccaaagcgag
actcggcctggggagtgtgtgctgaccttcaacttccagggcaaggccaagcaccttcgc
ctttctctgaatggtcacggccagtgtcatgtccaacacctgtggttccagtcggtgttt
gacatgcttcgacacttccacacccaccccattcccctggagtcaggaggatccgctgac
atcaccctacgaagctacgtgcgtgcccaaggtccacctcctgatccaggaccagcgccc
aacactgcagccccggtcccggcctgctggacggagccggctggccagcactacttctcc
agcctggccacggccacctgcccacccacttcaccctccaatggcgctggagcatcgtcg
tcatccggttcatcatcctctgctacgtccgtgcccccacgcccagccgaggggccactc
agtgcgcgcagtcgcagcaacagcacagagcacctgctagaggctgcatccggagccact
gaggagcccgcagatgccacgctgggccgcgctcgcgctgtggagaatcagtactccttt
tactag

DBGET integrated database retrieval system