KEGG   Rattus norvegicus (rat): 114207
Entry
114207            CDS       T01003                                 

Gene name
Ryr1
Definition
(RefSeq) ryanodine receptor 1 isoform X1
  KO
K04961  ryanodine receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04371  Apelin signaling pathway
rno04713  Circadian entrainment
rno04730  Long-term depression
rno04921  Oxytocin signaling pathway
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    114207 (Ryr1)
   04020 Calcium signaling pathway
    114207 (Ryr1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    114207 (Ryr1)
  09156 Nervous system
   04730 Long-term depression
    114207 (Ryr1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    114207 (Ryr1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    114207 (Ryr1)
   05020 Prion disease
    114207 (Ryr1)
   05022 Pathways of neurodegeneration - multiple diseases
    114207 (Ryr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    114207 (Ryr1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    114207 (Ryr1)
   04040 Ion channels [BR:rno04040]
    114207 (Ryr1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     114207 (Ryr1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   114207 (Ryr1)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Ryanodine receptor
   114207 (Ryr1)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_7 Serglycin DNA_pol_phi
Other DBs
NCBI-GeneID: 114207
NCBI-ProteinID: XP_038956779
RGD: 1586637
Ensembl: ENSRNOG00000020557
Position
1
AA seq 5035 aa
MGDGGGEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVP
PDLAICCFILEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLS
CLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERY
LHLSTASGELQVDASFMQTLWNMNPICSCCEEGFVTGGHVLRLFHGHMDECLTISPSDSD
DQRRLVYYEGGPVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLALTEDQGL
VVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTY
AAPDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNQFIKGLD
SFSGKPRGSGPPAGSALPIEGVILSLQDLIGYFEPPSEELQHEEKQTKLRSLRNRQSLFQ
EEGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRTNCAL
FSTNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKV
LDVLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGSTQY
GKWYFEVMVDEVAPFLTAQATHLRVGWALSEGYSPYPGGGEGWGGNGVGDDLYSYGFDGL
HLWTGHVARPVTSPGQHLLGPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFP
VVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLQPIKEYRREGPRGPHL
VGPSRCLSHLDFVPCPVDTIQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDD
NKRLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTY
MMNNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNP
RLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVDSQSRGDRARIFRAEK
SYAVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADDLAYVFNGHRGQRWHLGSEPF
GRPWQSGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFREIEIGDGFLPVCSLGPGQV
GHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEPVPLEHPHYEVAR
MDGTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLASPGLQPPA
EDEARAAEPDTDYENLRRSAGGWGEAEAGKDGTAKEGTPGGAAQPGVEAQPARAENEKDA
TTEKNKKRGFLFKAKKVAMMTQPPSTPALPRLPRDVVPADNRDDPEIILNTTTYYYSVRV
FAGQEPSCVWVGWVTPDYHQHDMSFDLSKVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGD
FVSPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQ
NVVQFELGKQKNIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLHVDTRR
AGERLGWAVQCQEPLMMMALHIPEENRCMDILELSERLDLQRFHSHTLSLYRSVCALGNN
RVAHALCSHVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLT
EETRAITLFPPGRSAEDGPRRHGLPGVGVTTSLRPPHHFSPPCFVVALPAAGAAEAPARL
SPAIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGVFSDED
VKQILKMIEPEVFTEEEEVEEEEEEEEEDEEEKEEDEEEEAHEKEDEEKEEAEEAAEEEK
EELEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQSNQRGRYGL
LMKAFTMSAAETARRTREFRSPPQEQINMLLQFKNGADEEDCPLPEEIREDLVNFHQDLL
AHCGIQLEGEEEEPEEESTLGSRLMSLLEKVRLVKKKEEKPEEEPAAEEHKPQSLQELVS
HTVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISLSSVEDTMSLLECL
GQIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGE
SKEIRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAAS
VIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAV
FVNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGVRR
DRRREHFGEEPPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRS
LVPLDDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLL
HVLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMV
DSMLHTVYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKM
PLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDQELYRIA
MPCLCAIAGALPPDYVDASYSSKTEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFA
EYAHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAW
EWTVEKAREGEEEKTEKKKTRKISQTAQTYDPREGYNPQPPDLSVVTLSRELQAMAEQLA
ENYHNTWGRKKKQELEAKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTR
GLKDMELDTSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFA
KILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGT
DAPAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQAR
TQVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTR
NPYVEKLRPALGECLARLAAAMPVAFLEPELNEYNACSVYTTKSPRERAILGLPNSVEEM
CPDIPVLERLMAEIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPALPAG
APPPCTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLRSHFI
PTIGRLRKRAGKVVAEEEQLRLEAKAEAEEGELLVRDEFSVLCRDLYALYPLLIRYVDNN
RAHWLTEPNPNSEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMA
KAGDVQSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLIVLAKAR
YALKDTDEEVREFLQNNLNLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEV
SAVLYHLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKA
SWILTEDHSFEDRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDED
YLYMAYADIMAKSCHLEEGGENVEEGGEEEEVEVSFEEKEMEKQRLLYQQSRLHNRGAAE
MVLQMISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQ
TCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNN
DFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSV
AKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELL
DLQKDMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAF
QDYVTDPRGLISKKDFQKAMDSQKQFTGPEIQFLLSCSEADENEMINCEEFANRFQEPAR
DIGFNVAVLLTNLSEHVPHDPRLRNFLELAESILDYFRPYLGRIEIMGASRRIERIYFEI
SETNRAQWEMPQVKESKRQFIFDVVNEGGESEKMELFVSFCEDTIFEMQIAAQISEPEGE
PEEDDDEGAEEAEEGAAGPDGSGSAAAAGVWTWLATAAGRTLRGLSYRSLRRRVRRLRRL
TAREAATAVAVLLWAMVARAGGAGAGAAAGVLRLLWGSLFGGGLVDSAKKVTVTELLAGM
PDPTGDEVHGQQPSGAGSDAEGEGQGEGEGDAAEGVGDEEVAADQAGTGGADRTVAVADG
SPFRPEGAGGLGDMGDTTPVEPPTPEGSPILKRKLGVDGEEEEPQPEPEPEPEPEPEKAD
TENGEKEVPEPPPEPPKKAPPPPPPKKEEAGGAGLEEFWGELEVQRVKFLNYLSRNFYTL
RFLALFLAFAINFILLFYKVSDSPPGEDDIEGSGAGDMSGAGSGDGSGWGSRASEEVEGD
EDENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELARKLE
FDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIFGRERIAELLG
MDLASLEITAHNERKPDPPPGLLTWIMSIDVKYQIWKFGVIFTDNSFLYLGWYMVMSLLG
HYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKF
YNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFF
FVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEE
HNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLG
NT seq 15108 nt   +upstreamnt  +downstreamnt
atgggtgatggaggaggtgaaggcgaggacgaggtccagtttttgcggacggacgacgaa
gtggtcctgcagtgcagcgccaccgtgctcaaggagcagctcaagttgtgtctggccgct
gagggtttcggtaatcgcctctgcttcctcgaacccaccagcaacgcgcagaatgtaccc
cctgatctggccatctgctgctttatcctggagcagtctctgtcagttcgagccctgcag
gagatgctggccaatactgtggaggccggtgtagagtcatcccagggcgggggacacagg
acactcttgtatggccatgccatcctgctccggcacgcacacagccgtatgtacctgagt
tgcctcaccacctcccgatccatgactgacaagttggcctttgatgtgggattacaggaa
gacgccacaggggaggcctgttggtggacgatgcacccagcctcgaagcagaggtctgaa
ggagagaaggttcgagttggggatgacctcatccttgtgagtgtctcctctgagcgatac
ctgcacctgtcaaccgcaagtggggaactccaggtggatgcctccttcatgcagactctg
tggaatatgaaccctatctgctcctgctgtgaagaaggctttgtgactggaggacatgtc
ctccgcctctttcatggacatatggatgaatgtctgaccatttccccttctgacagtgat
gaccaacgcagacttgtctactacgagggagggcctgtgtgcacccatgcccgctccctg
tggaggctggagccactgagaatcagctggagtggaagccatctccgctggggccagcca
ctaagaatcaggcatgtgaccacagggaggtaccttgcgctcactgaggaccaaggcctt
gtggtggttgatgccagcaaggcccacaccaaggccacttccttttgcttccgcatctcc
aaggagaagctggatgtggcccccaagagagatgtggagggcatggggccccctgagatc
aagtatggagagtcactctgctttgtgcagcatgtggcctcaggtctgtggctcacctat
gcggccccagaccccaaggccctgaggcttggggtactcaagaagaaggccatgctgcac
caggaaggccacatggatgatgcgctatcactgacgcgatgccagcaggaggagtcccag
gctgcccggatgatatacagcactgcgggcctgtacaaccagttcataaagggtctcgat
agcttcagcgggaagccacggggttcggggccaccggctgggtcagcactgcccatcgag
ggcgtcatcctgagcctacaagacctcatcggctatttcgagccgccttcggaggagctg
cagcacgaggagaagcagaccaagctccgcagcctgcgcaaccgacaaagcctcttccag
gaggaggggatgctctccctggtcctgaattgcattgatcgcctcaatgtctacaccacc
gcagcccattttgctgaatttgcaggggaggaggcagctgaatcctggaaagagattgtg
aacctgctctatgaacttctagcttctctgatccgtggcaatcgcaccaactgtgccctc
ttttccacaaacttggattggctggtcagcaaactggatcgtctggaggcctcatctggc
atcctggaggtgttgtactgtgttctgattgagagtcctgaggtgctaaacatcatccag
gagaaccacatcaagtctatcatctccctcttagacaagcatgggaggaatcacaaggtc
ctggatgtgctatgctcactctgtgtgtgcaatggtgtagctgtgcgctccaaccaggat
ctcattactgagaacttgctcccgggccgtgaacttctgctgcagacaaaccttatcaac
tacgtcaccagcatccgtcccaacatctttgtgggccgagcagagggctccacgcagtat
ggcaagtggtacttcgaggtgatggtggacgaggtggctccgtttctgacagctcaggcc
acccacctgcgggtgggctgggccctcagcgagggctacagtccctaccctggaggtggc
gagggctggggcggcaacggggtcggcgatgacctctattcttacggctttgatgggctg
cacctctggacagggcatgtggcacgcccagtgacttctcccggacaacacctcttgggc
ccggaggatgtggtcagctgctgcctggacctcagcgtaccatccatctcctttcgtatc
aatggctgccccgtgcagggtgtctttgaatccttcaacctcgatgggctctttttcccc
gtcgtgagcttctccgctggtatcaaagtgcgcttcctccttggcgggcgccacggtgaa
tttaagttcctgcccccacctggctatgccccatgccatgaagctgtgcttcctcgggag
cggctccatctccaaccaatcaaagagtatcgcagggaagggcctcgggggccccacctg
gtgggccccagtcgctgcctctcacatctggactttgtgccctgccctgtggacaccatc
cagatcgtcttgcccccccacctggagcgaattcgggagaagctggcagagaacattcat
gaactctgggcactgactcgcattgagcagggatggacctatggtccggttcgggatgac
aacaagaggctgcacccatgtcttgtggattttcacagcttgccagagcctgagcggaat
tacaacttgcagatgtcaggggagacactcaagactctgctggccctgggctgccatgtc
ggcatggcagatgagaaggcagaggacaacctgaagaagacgaagctccctaagacgtat
atgatgaacaacggatataagccggctcctctggacctgagccacgtgaggctgacgcct
gcgcagacgactctggtggaccggctggcagagaacgggcacaatgtatgggcgagagac
cgggtggcacagggctggagctatagcgctgtgcaggacatccctgcacgcagaaaccct
cgcctcgtgccctaccgcctgcttgacgaggccaccaagcgcagcaaccgggacagcctc
tgccaggctgtgcgcacactcttgggctatggctacaacatcgagccacctgaccaggag
cccagtcaggtggacagccagtctcgaggcgaccgggcccgcatcttccgggcggagaag
tcctatgcagtccagagcggccgctggtacttcgagtttgaagcagtcaccacaggagag
atgcgagtggggtgggcaagacctgagctgagacctgacgtggagctgggggctgatgat
ctggcctatgtcttcaatgggcaccgaggccagcgctggcacttgggcagtgagccattc
ggacgtccctggcagtcgggtgatgtcgttggctgcatgattgatctcacggagaacacc
atcatcttcaccctcaatggcgaggtcctcatgtctgactcgggctcggaaacagccttc
cgagaaattgagattggggacggcttcctgccagtctgcagcttgggacctggtcaggtg
ggccacctgaacctgggccaggatgtgagctccctgaggttttttgccatctgtggcctc
caggaaggctttgagccgttcgccatcaacatgcaacgcccagtgaccacctggtttagc
aagagccttcctcagtttgagcctgtgcccctcgaacacccccactatgaggtggcccgc
atggatggcactgtggatacacctccctgcctgcgcttgactcaccgtacctggggctca
cagaacagtctggtggagatgctgtttctccggctaagccttccggtccagttccaccag
cacttccgctgcaccgcaggggccacacccctcgcatcccctggcctgcagccgcctgcg
gaagatgaggcccgggcagcagaaccggatacggactatgagaacctgcgccgctctgct
ggaggctggggagaggctgaggcgggcaaggatggaactgccaaggaggggacacccgga
ggcgctgcccagccaggggtagaggctcagcctgcaagggcggagaatgagaaagacgcc
accacggagaagaacaagaagagagggttcttattcaaggccaagaaggttgccatgatg
acccaaccaccttccaccccggctcttccccgactccctcgagatgtagtacctgctgac
aaccgtgacgaccctgagatcatcctcaacaccaccacgtactattactctgtgagggtc
ttcgcgggtcaggagcccagctgcgtgtgggtgggctgggtcactcctgactaccatcaa
catgacatgagcttcgacctcagcaaggtccgggcggtgacagtgaccatgggggatgaa
caaggcaatgtccacagcagcctcaagtgtagcaactgttacatggtgtggggcggggat
ttcgtgagtccgggacagcaaggccgcatcagccacacggacctagtcattggatgcctg
gtggatctggccaccggcttgatgacctttacagccaatggcaaagaaagcaacaccttc
ttccaggtggagcccaacacaaagctgtttcctgccgtctttgtcctgcccacccaccag
aacgtggtccagtttgagttggggaagcaaaagaacatcatgccgctgtcagccgccatg
ttcctcagcgagcgcaagaatccagccccgcagtgcccaccaaggctggaggtgcagatg
ctgatgcctgtctcctggagccgaatgcccaaccacttcctacatgtggacacgcggcgt
gctggcgagcggctgggctgggctgtgcagtgccaggagccgctgatgatgatggcgcta
cacatcccggaggagaacaggtgcatggacatcctggagctgtctgagcggctggatcta
cagcgcttccactcgcacacgctctcgctctaccgctccgtgtgcgccctgggcaacaac
cgcgtggctcatgccctgtgcagccacgtggaccaggcacagctgctgcatgctctggaa
gacgcgcacttgccgggtcctctgcgtgcaggctactatgacctcctcatcagcatccac
ctcgaaagcgcctgccgcagccgtcgctccatgctctctgagtacattgtgccgctcaca
gaggagacccgagccatcacgcttttcccacccggtcgtagcgcggaagatggcccccgc
cgccatggcctgcctggcgttggggtcacaacctccctgagacctccacaccacttctca
cccccgtgttttgtggtcgccctgccagctgctggggccgcagaagctccggctcgcctc
agccctgccatccctctggaggctctgcgagacaaggcgctgagaatgttgggggaagcc
gtgcgtgacggaggacagcatgctcgcgacccagtagggggctctgtggagttccagttt
gtgccggtgctcaagcttgtgtctaccctcctggtgatgggtgtctttagcgacgaggat
gtgaagcagatcctgaagatgatagagcctgaagtcttcaccgaggaagaagaggtggag
gaggaggaagaggaggaagaggaagatgaggaggagaaagaggaggacgaggaggaagag
gcacacgagaaggaagatgaggaaaaagaagaggcagaggaggccgcagaggaggagaag
gaagagctggaggaggggctgctgcagatgaagttgcctgagtctgtgaaattacagatg
tgccacctcctggagtatttctgtgaccaagagctgcagcaccgggtggagtccttggca
gcctttgcggagcgatatgtggacaagctgcagagcaatcagcggggtcgctacggcctc
ctcatgaaagccttcaccatgagcgcggccgagactgcaaggcgcacgcgggagttccgc
tctccgccccaagagcagatcaacatgctattgcaattcaaaaatggtgccgatgaggaa
gattgtcctctccctgaagagatccgagaggatttagttaactttcaccaagacctgttg
gcacattgtggaatccagctggagggagaggaggaggagccagaggaagagagcactctg
ggcagccgcctcatgagcctgttggagaaggtgcggctggtgaagaagaaagaggagaag
cctgaggaggagccggcagctgaggagcacaagcctcagtccttgcaggagctggtgtcg
cacacagtggtgcgctgggcccaggaggacttcgttcagagcccagagctggtccgagcc
atgttcagcctcctgcaccggcagtacgatggactcggcgagctgctgcgtgccctgcct
cgggcctacacgatctctctgtcctcagtggaggacaccatgagcctgctggagtgtctg
ggccagatacgctcactgcttattgtgcagatgggtccccaggaggagaacctcatgatc
cagagcattgggaacatcatgaataacaaagtcttctaccagcacccaaacctgatgaga
gcgctcggtatgcacgaaactgtcatggaggtcatggtgaatgtcctcgggggcggcgag
tcaaaggagatccgcttccccaagatggtgacaagctgctgccgtttcctctgctacttc
tgccggatcagccggcagaaccagcgctctatgtttgaccacctgagctacctgctggag
aacagtggcattggcctggggatgcagggctccacgcccctggatgtagcagctgcttct
gtcattgacaacaatgagctggccttggcattacaggagcaagacctggaaaaggttgtg
tcatacttggcagggtgtggcttacaaagctgccccatgctcctggccaaaggctatcct
gacatcggatggaatccctgtgggggcgagcgctacctggacttcctgcgctttgccgtc
tttgtcaacggtgagagcgtggaagagaacgctaatgtggtagtgcggctgttgatccga
aagcccgagtgctttggacctgccctgcggggtgagggtggctcagggctgctggctgcc
atcgaagaagccatccgcatctccgaggaccctgcacgggatgggccgggtgtccgcagg
gaccggcgacgtgagcactttggtgaggaaccccctgaagagaaccgggtacatctagga
cacgccatcatgtccttctatgctgctttgattgacctgctgggacgctgtgctcctgag
atgcatctgattcaagccggtaagggtgaggccctgaggatccgtgctatccttcggtcc
ctcgtgcctttggatgaccttgtgggcatcatcagcctcccactgcagatccccaccctg
ggcaaagatggcgcactggttcagccaaagatgtctgcatccttcgtgcctgaccacaag
gcatccatggtgcttttcctggaccgagtgtatggcattgagaaccaggacttcttgctg
catgtgctggatgtggggttccttcctgacatgagggcagctgcctcactggacacggct
actttcagcaccacggagatggcgctggcacttaaccgctacttgtgcctggctgtgctg
ccgctcatcaccaagtgcgcgccactctttgcgggcaccgagcaccgcgccatcatggtg
gactccatgctgcacacagtataccgactgtcgcggggccgctcgctcaccaaagcacag
cgcgacgtcattgaggactgcctcatggcgctgtgcaggtatatccgcccgtccatgctg
cagcacctgcttcgacgcctggtgttcgatgtgcccatcctcaatgagtttgccaagatg
cctctcaagctccttaccaaccactacgagcgttgctggaagtactactgccttcccaca
ggctgggccaacttcggggtcacctctgaggaagagctgcacctcacacgcaagctcttc
tggggcatctttgattctctggcgcataagaaatacgaccaggagctttaccgaatagcc
atgccgtgtctctgtgccattgcgggggcactgccccccgactatgtggatgcctcatac
tcctccaagacggagaaaaaagccacagtggatgcggaaggcaactttgatccccggcct
gtggagaccctcaatgtcatcatcccagagaagctggactccttcattaacaagttcgca
gaatatgcccatgagaagtgggcctttgacaagattcagaacaactggtcctatggcgag
aacattgatgaagaactgaagacccaccccatgctgagaccctacaagaccttctcagag
aaggacaaagagatttaccgctggcccatcaaggagtccttgaaggccatgattgcctgg
gaatggacggtcgagaaggccagggaaggtgaggaggaaaagaccgaaaagaaaaaaaca
agaaagatatcccaaacggcccagacatatgaccctcgagaaggctacaatccccagcca
ccagacctcagtgtggttacgttgtcccgggagctgcaggccatggctgaacaattggca
gagaattatcacaacacttgggggcgaaagaagaagcaagagctggaggctaaagggggt
gggtcccatcctctgctggtcccctacgacacgcttacggccaaggagaaggcgcgggac
cgggagaaggcccaggagttgctgaagtttctgcagatgaatggctatgctgtcaccagg
ggtcttaaggacatggaactggacacatcttccattgagaaacgatttgcctttggcttc
ctgcagcagctgctgcgctggatggacatctcccaggagtttatcgcccacttggaggct
gtggtcagcagtggacgggtagagaaatccccacatgaacaggagattaaattctttgct
aagattctgctgcctttaatcaaccaatacttcaccaaccactgtctctacttcctatcc
acaccggccaaagtgctgggcagtggtggccatgcctccaacaaggagaaggaaatgatc
accagcctcttctgtaaacttgctgctcttgtccgccaccgagtctccctctttgggacg
gatgccccagctgtggtcaactgtcttcatatattggcacgttccctggatgccaggacg
gtgatgaaatcgggccctgagatcgtaaaggcgggtctgcgctccttcttcgagagtgcc
tcggaggacattgagaagatggtggagaacctgcggctaggcaaggtgtcccaggcacgc
acgcaggtgaagggtgtgggccagaacctcacctacaccacagtggctctgctgcctgtc
ctcaccaccctcttccagcacatcgcccagcaccagttcggagatgatgtcatcctggat
gacgttcaagtttcttgctaccgaacactatgcagtatctactctctgggaaccaccagg
aacccctacgtggaaaagctgcggccagccctgggggaatgcctggcccgcctggccgca
gccatgccagtggcattcctggagcctgagctgaatgaatacaacgcctgctctgtctac
accaccaagtctcctcgagagcgggccatcctggggcttcccaacagtgtggaagagatg
tgtccagacatcccggtgctagaacggcttatggcagagatcggggggctggccgagtcc
ggggcgcgctacaccgagatgccgcacgtcatcgagatcacactgcctatgctgtgcagc
tacctgccccgctggtgggagcgagggcctgaggcgcccccaccagccctgcctgcagga
gccccaccaccctgtacagccgtcacctccgatcacctcaattccctactggggaacatc
cttcgaatcatcgtcaataacctgggcatcgatgaggcctcgtggatgaagcggttggct
gtgtttgcccagcccatcgtgagccgtgccaggccagagctcctacgctcccacttcatc
cctactatcgggcgactgcgtaagcgggcagggaaggtggtggctgaggaggagcagctg
cgcctggaggccaaggcagaggctgaggagggtgagctcctggtccgggatgagttctcc
gtgctctgccgtgacctgtatgccctctacccactgctcatccgctacgtagacaacaac
agggcacactggctgacagagcccaatcccaactcggaggagctgttcaggatggtggga
gaaatcttcatctactggtccaagtcccacaactttaagcgtgaagaacagaacttcgtg
gtccagaacgagattaacaacatgtcctttttgaccgctgacaataagagcaaaatggcc
aaggcaggagacgtacagtcaggtggctcggaccaggaacgcaccaagaagaaacgccgg
ggggaccgctactcggtgcagacatccttgatcgtggccacgctcaagaagatgttaccg
ataggactaaacatgtgtgctcccactgaccaggacctcattgtgctggccaaggcccgc
tatgcgctgaaagatacagatgaggaggttcgtgaattccttcaaaacaaccttaacctt
cagggaaaggtggaaggctcaccatctcttcgctggcaaatggcactgtaccgcggcgtt
ccaggccgcgaggaagatgccgatgatcctgagaaaatcgtgcgcagagtccaggaagtg
tccgctgtgctctatcacctagaccagacggagcatccttacaagtccaagaaggcggtg
tggcataaacttttgtccaagcaacgccggagggcagtggtggcctgtttccgcatgacg
cccctatacaacttacccacgcaccgagcatgcaacatgttcttggagagctacaaagcc
tcctggatcctgactgaggaccacagtttcgaggaccgcatgatagatgacctatcaaaa
gctggggagcaggaggaagaggaggaagaagtggaggagaagaagccagaccccctacac
cagttggtcctacacttcagccggacagctctgactgaaaagagcaaactggatgaggac
tacctgtacatggcttacgctgacatcatggcaaagagctgccacctggaggagggcggg
gaaaatgtcgaagaaggaggtgaagaagaggaagtggaggtgtcctttgaggagaaggag
atggagaagcagaggctcctgtaccagcagtcgaggctgcacaaccggggtgccgccgag
atggtactgcagatgatcagtgcttgcaaaggagagacgggtgccatggtgtcttccacc
ctgaagctgggcatctccatcctcaacggagggaacgctgaagtgcagcagaaaatgctg
gattacctgaaggacaagaaggaagtgggcttcttccagagtatccaggcgctaatgcaa
acgtgcagcgtcctggacctcaatgcctttgagaggcagaacaaggcggaggggctgggc
atggtgaatgaagacgggactgtcatcaatcgccagaacggagagaaagtcatggcagat
gatgagttcacacaggacctgttccgcttcctgcagctgctctgcgagggccataacaac
gatttccaaaactacctacggacacagactgggaacaccaccaccatcaatatcatcatc
tgcacagtggactacctcctgcggctgcaggaatccatcagtgacttctactggtactac
tcgggcaaggatgtcattgaggagcagggaaagagaaacttctccaaagccatgtcggta
gcgaaacaagtgttcaacagcctcactgagtacatccagggaccctgcaccggaaaccag
cagagtctagcgcacagtcgcctctgggatgctgtggtgggcttcctgcacgtgttcgca
cacatgatgatgaagctggctcaggactctagccagatagagctgctgaaggagctgctg
gacctgcaaaaggacatggtggtgatgttgctgtcccttctggaaggaaatgtggtgaac
ggcatgatcgcacggcagatggtggacatgctcgtggagtcttcgtccaatgtggagatg
atcctcaagttcttcgacatgtttctgaagctcaaggacatcgtgggctctgaggccttc
caggactacgtcaccgatccccgtggcctcatctccaagaaggacttccagaaggccatg
gacagccagaagcagttcactggcccagagatccagttcctgctttcgtgttcagaagca
gatgagaatgagatgatcaattgtgaagagtttgcgaaccgcttccaggaaccagcgcgg
gacattggcttcaacgtggcagtgctgctcaccaacctgtcagagcatgtgccccacgac
ccgcgcctgcgcaacttcctggagttggctgagagcatcctggattacttccggccttac
ctgggccgcatcgaaatcatgggcgcatcgcgtcgcatagaacggatctacttcgaaatc
tcagaaaccaaccgtgcccagtgggagatgccccaggtgaaggagtctaagcgccagttc
atcttcgacgtggtgaacgagggcggcgagtccgagaagatggagctgttcgtgagcttc
tgcgaggacacgatcttcgagatgcagatcgctgctcagatctctgagccggagggcgag
ccggaggaggacgatgatgagggcgctgaggaggctgaggagggcgcagcgggtcccgac
gggtcgggctctgcagcggccgcaggggtgtggacgtggctggcgacggcggcgggccga
acgctgcggggtctgagctaccggagcctgcggcgacgtgtgcggaggctgcggcggctg
acggcgcgggaggctgccacggccgtggccgtgttgctctgggcgatggtggcccgcgcg
gggggcgcgggcgcgggcgcggcggccggggtactgcggctgctctggggctcgctgttc
ggtggtgggctggtagacagcgccaagaaggtgactgtgaccgagctcttggcaggcatg
ccggaccccactggcgacgaggtgcacggtcagcagcctagcggcgctggcagcgatgcg
gagggcgagggccagggtgagggcgaaggggatgcggctgaaggcgtcggagatgaagag
gtggcagcggaccaggctggcacgggaggtgctgaccggacggtggccgtagccgatggg
agccccttcaggccagaaggagccggtggtctcggggatatgggtgacacgacaccagtg
gagcccccaacgccagagggctcgcccatcctcaagaggaagctgggggtggacggagaa
gaagaggagccgcagccagagccagagccggagccagagcctgaaccggaaaaagctgat
accgagaatggagagaaggaagtccctgagccgcctccggagccccccaagaaggcacct
cctccaccccctccaaagaaggaggaagctggaggtgcaggcctggaagaattctggggt
gaactggaagtgcagagggtgaaattcttgaactacttgtcgaggaacttctacacgctg
cgattcctggccctcttcctggcatttgccatcaactttatcttattgttttataaggtt
tcagactctccgccaggggaggatgacatagaaggttccggagctggggacatgtcaggg
gcagggtctggtgatggctctggctggggctccagagccagcgaggaggtagagggtgat
gaagatgagaacatggtgtactacttcctggaggagagcaccggctacatggaacctgcc
ctgaggtgcttgagcctgctgcataccctggtggcctttctctgcatcattggctacaac
tgtctcaaggtgccccttgtgatctttaagagggagaaggagctggcccggaagctggag
ttcgatggtctctacattacagagcagccagaggatgatgatgtgaagggacagtgggat
cgcctggtgctcaacacaccgtctttccccagcaactactgggacaagtttgtcaagcgg
aaggttctggacaaacacggggacatcttcgggcgggagcggattgcagagctgctgggc
atggatctggcctctctggagatcacagcccacaatgagcgcaaacctgaccctccacca
ggcctgctgacatggatcatgtccatcgatgtcaaataccagatctggaagtttggagtc
atcttcacagacaactctttcctgtatctgggctggtacatggtgatgtccctcctgggc
cactacaataacttcttcttcgctgcccacctcttggatatcgccatgggagtcaagacg
ctgcgcaccatcctttcatccgtcactcacaacggaaagcagctggtgatgacagtaggg
ctcctggctgtagtggtctacttgtatacggtggtggccttcaacttcttccgcaagttc
tacaacaagagcgaagatgaggacgagcctgacatgaagtgtgacgacatgatgacgtgc
tacctgttccacatgtatgtgggcgtccgggccggtggtggcatcggggacgagatcgag
gacccggctggtgatgaatatgaactgtaccgggtcgtcttcgacatcacctttttcttc
ttcgtcattgtcatcctactggctatcatccagggtctgattattgatgctttcggggag
ctccgagaccaacaagagcaagtgaaggaagacatggagaccaagtgcttcatctgtggg
ataggcagtgactacttcgacacgaccccacatgggtttgagacccacactctggaagag
cacaacctagccaattacatgtttttcctgatgtatttgataaataaggatgagacagag
cacaccggtcaggagtcatatgtctggaagatgtaccaggagaggtgctgggacttcttc
cctgctggagactgtttccgaaagcagtatgaggaccagcttggctga

DBGET integrated database retrieval system