KEGG   Rattus norvegicus (rat): 114208Help
Entry
114208            CDS       T01003                                 

Gene name
Skil, Skir, Sno
Definition
(RefSeq) SKI-like proto-oncogene
  KO
K18499  Ski-like protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    114208 (Skil)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ski_Sno c-SKI_SMAD_bind DUF489 FapA
Motif
Other DBs
NCBI-GeneID: 114208
NCBI-ProteinID: XP_006224156
RGD: 621399
Ensembl: ENSRNOG00000009899
UniProt: D3ZWL1
Position
2q24
AA seq 677 aa AA seqDB search
MENLQSNFSLVQGSNKKLSGMEDDGSPPVKKMMTDIHANGKTLTQVKKEHLDDYGDASVE
PDGEHAKRNCPSLPETLNLNPSLKHTLAQFHLSSQSSLGGPAAFSARYSQESMSPTVFLP
LPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFSLQQI
NTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNG
SILPAKSSWAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTF
VMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRNGKRI
QSKTDTPSGMELPPWYPVIKQEGDHGPQTHSFLHPSYYLYMCDKVVAPNVSLASAASQSK
AVTKAETSKSISKQSEKPHDSSKRQKTVSYPDVSLEEQEKMDLKTSRELYSCLDSSVSNN
STSKKKCESTICDLVRDTDKQGSGASSPLVVRDVTCEDDKGKIVEDVMRTYVRQQEKLSS
ILQKKQQLQMEVEMLSSSKAMKELTEEQQNLQKELESLQNEHAQRMEEFYIEQRDLEKKL
EQVMKQKCTCDSNVEKDKEAEYAAQLAELRQRLDHAEADRQELQDELRQEREARQKLEMM
IKELKLQIVKSSKTAKE
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacctgcagtctaatttctccttagttcagggttcaaataaaaagctgagcggg
atggaggatgatggcagtcctcccgtgaaaaaaatgatgacagacattcatgccaatggg
aaaacgctgacccaggtgaagaaggagcatttggacgactacggagatgcgtcagtggaa
ccagatggcgagcacgccaagcgcaactgtccttctctacctgaaactttaaatttaaac
cccagtctgaaacacacactggcacaattccatttaagtagtcagagctctttgggtgga
ccagcagctttttctgctcgatattcccaagaaagcatgtcaccgactgtgttcctgcct
cttccgtctcctcaggttcttcctggtcctcttcttattccttctgatagctccacagag
ctcactcagactgttttggaaggggagtctatttcttgttttcaagtcggaggagaaaag
agactgtgtttgccccaagtcttaaattctgttctccgagaattttcactccagcaaata
aacacagtatgcgatgagctctacatctattgttcaaggtgtacttcagaccagcttcat
atcttaaaggtcttaggtatacttccattcaatgccccctcctgtgggctgatcacgttg
actgacgcacagagactctgtaatgctttactgaggccacgaacttttcctcaaaatggt
agcatacttcctgctaaaagctcttgggcccagctgaaggagactggcagtgcctttgaa
gtggaacatgagtgcttgggcaaatgtcagggtctctttgcacctcagttttatgttcag
cccgatgctccctgtatccagtgtctggagtgctgtggaatgtttgctcctcagacattc
gtcatgcattcacacagatcccctgacaagagaacttgccattggggctttgagtcagcc
aagtggcactgttaccttcatgtgaaccaaaaatacctagggacacccgaagaaaagaaa
ctgaagataattttagaggaaatgaaggagaagtttagcatgagaaatggaaagagaatc
caatcaaagacagatacgccttcgggaatggaattgccaccatggtatcctgttataaaa
caggaaggtgaccacggtcctcagacccattcatttttacaccccagctactacttgtac
atgtgtgacaaagtggttgcaccgaatgtgtcgctcgcctctgctgcgtcccagtctaaa
gcggtcaccaaggcagagacaagtaagtccatctccaaacagtcagaaaagcctcatgat
agtagtaagcgccaaaagacagtgtcttacccagacgtctcacttgaggagcaggagaaa
atggatttaaaaaccagtagagaattatacagttgtttagattcatcggtctcaaataat
tctacaagtaaaaagaaatgtgaatctaccatttgcgacttagtgagagacacagacaag
cagggttctggagcctcctctccactcgtggtccgagatgttacttgtgaagatgacaag
gggaagatcgtggaagacgtgatgagaacctatgtgagacagcaggagaagctgagctca
attctacagaagaagcagcagttgcagatggaagtggagatgctgagcagttcaaaggcg
atgaaggagctcactgaagagcagcagaatctacagaaagagcttgagtctttgcagaat
gagcatgctcagaggatggaggaattttatattgagcagagagacttagagaagaagttg
gagcaggtgatgaagcagaagtgcacctgtgactcaaacgtagagaaagacaaagaggct
gaatacgcagcccagctggcagaactgaggcaaagactagaccatgctgaggccgacagg
caagaactgcaagatgaactgagacaggagcgggaggcgaggcagaagctagagatgatg
ataaaggaactgaagctgcagatcgtgaagtcgtccaagaccgccaaggagtaa

DBGET integrated database retrieval system