KEGG   Rattus norvegicus (rat): 114212Help
Entry
114212            CDS       T01003                                 

Gene name
Chek2, Chk2, Rad53
Definition
(RefSeq) checkpoint kinase 2
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04115  p53 signaling pathway
rno04218  Cellular senescence
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114212 (Chek2)
   04115 p53 signaling pathway
    114212 (Chek2)
   04218 Cellular senescence
    114212 (Chek2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114212 (Chek2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    114212 (Chek2)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    114212 (Chek2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114212 (Chek2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   114212 (Chek2)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    114212 (Chek2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr FHA Kinase-like RIO1 Kdo Pkinase_fungal APH Haspin_kinase YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 114212
NCBI-ProteinID: NP_446129
RGD: 621543
Ensembl: ENSRNOG00000037509
UniProt: Q9R019
Position
12q16
AA seq 545 aa AA seqDB search
MKSHQSHGSTSSKAHDSASCSQSQGGFSQSQGTPSQLHDLSQYQGASSSSTSTVPSSSQS
SHSSSGTLSSLETVSTQELCSIPEDQEPEEPGPTPWARLWALQDGFSNLDCVNDNYWFGR
DKSCEYCFDGPLLKRTDKYRTYSKKHFRIFREMGPKNCYIVYLEDHSGNGTFVNTELIGK
GKRCPLSNNSEIALSLCRNKVFVFFDLTVDDQSVYPKELRDEYIMSKTLGSGACGEVKMA
FERKTCKKVAIKIISKRRFALGSSREADTAPSVETEIEILKKLNHPCIIKIKDVFDVEDY
YIVLELMEGGELFDRVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSS
QEEDCLIKITDFGQSKILGETSLMRTLCGTPTYLAPEVLISNGTAGYSRAVDCWSLGVIL
FICLSGYPPFSEHKTQVSLKDQITSGKYNLIPEVWTDVSEKALDLVKKLLVVDPKARLTT
EEALSHPWLQDEHMKKKFQDLLVQEKNLVPLPLAPAQTSGQKRPLELEAEDAESSKRLAV
CKAVL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtcatcagtcccacggcagcacctcctcgaaggctcatgacagtgcttcctgt
tcacagtctcaaggcggcttcagccagtcccaaggcaccccctctcagttgcacgacctc
tcacagtatcagggtgcatccagttcctccaccagcacagtgccatcctccagccagtcc
tcccactccagctctgggaccctgagctctttagagacagtgtctactcaggaactctgt
tctattcctgaggaccaagaaccggaagagcctggacctactccttgggctcggctatgg
gctcttcaggatggattctcgaatctagactgtgttaatgacaactactggttcgggagg
gataaaagctgtgaatattgcttcgatggaccactgttgaaaaggacggataagtaccgg
acttacagcaagaagcactttcgcatcttcagggaaatgggccctaagaattgttacatt
gtatacctagaagaccacagtggaaatggaacctttgtaaatacagagcttatcgggaaa
ggaaaacgctgtcctttgagtaacaactctgaaatcgcactttcactgtgtagaaataaa
gtttttgtattttttgatctgactgtagatgaccagtcagtttatcctaaggaattaaga
gacgaatacatcatgtcaaaaactcttggaagcggtgcctgtggggaggtaaagatggcc
tttgagaggaaaacgtgtaagaaagtggccataaagatcatcagcaagcggaggttcgcc
cttggctcgtccagagaagctgacacagctcccagtgtggaaactgaaatagaaattttg
aagaagctgaatcatccgtgcatcatcaagattaaagatgtctttgatgtggaagattat
tacattgttctggaactgatggaaggaggagaattgtttgaccgtgtggtggggaacaaa
cgcctgaaggaagccacctgcaagctctatttctaccaaatgcttttagctgtacagtac
cttcatgaaaatgggatcatacatcgggacctaaagccagagaatgttcttctgtcatct
caggaagaggactgtcttatcaagatcactgattttggacagtccaagatcttgggggag
acctccctgatgaggactctatgtggtacgcccacttatctggctcctgaggtccttatc
tccaacgggactgctgggtacagccgggccgtcgactgctggagcctaggagtcattctt
ttcatctgcctaagtgggtatccacctttctctgagcataagacccaagtgtcactgaag
gatcagatcaccagtggaaagtacaaccttattccggaagtctggacagatgtctcagag
aaggctctggaccttgtcaagaaactactggttgtggatccaaaggccaggcttaccaca
gaggaagccttaagtcatccttggcttcaggatgagcacatgaagaagaagtttcaggat
ctgctggtgcaggaaaagaacttggtgcccctccctctggctcctgcccagacttccggt
caaaagcggcccctggaactggaggcggaggacgcggagagctcgaagcgcctggccgtg
tgtaaggctgtgttgtga

DBGET integrated database retrieval system