KEGG   Rattus norvegicus (rat): 114244Help
Entry
114244            CDS       T01003                                 

Gene name
Hcn2
Definition
(RefSeq) hyperpolarization activated cyclic nucleotide-gated potassium channel 2
  KO
K04955  hyperpolarization activated cyclic nucleotide-gated potassium channel 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    114244 (Hcn2)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    114244 (Hcn2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    114244 (Hcn2)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (HCN)
   114244 (Hcn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ion_trans_N cNMP_binding Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 114244
NCBI-ProteinID: NP_446136
RGD: 620689
Ensembl: ENSRNOG00000008831
UniProt: Q9JKA9
Position
7q11
AA seq 863 aa AA seqDB search
MDARGGGGRPGDSPGATPAPGPPPPPPPPAPPQPQPPPAPPPNPTTPSHPESADEPGPRS
RLCSRDSSCTPGAAKGGANGECGRGEPQCSPEGPARGPKVSFSCRGAASGPAAAEEAGSE
EAGPAGEPRGSQASFLQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPY
SDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGI
VIEDNTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGIDSEVYKTARALRIVR
FTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFL
VPMLQDFPSDCWVSINNMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLS
MIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHR
YQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQP
GDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTY
CRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLHKVQHDLSSGVFNNQE
NAIIQEIVKYDREMVQQAELGQRVGLFPPPPPPQVTSAIATLQQAVAMSFCPQVARPLVG
PLALGSPRLVRRAPPGPLPPAASPGPPAASPPAAPSSPRAPRTSPYGVPGSPATRVGPAL
PARRLSRASRPLSASQPSLPHGAPAPSPAASARPASSSTPRLGPAPTTRTAAPSPDRRDS
ASPGAASGLDPLDSARSRLSSNL
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgcgcgggggcggcgggcggccgggcgatagtccgggcgcgacccctgcgccg
gggccgccgccaccgccgccgccgcccgcgccccctcagcctcagccaccacccgcgcca
cccccgaaccccacgaccccctcgcacccggagtcggcggacgagcccggcccgcgctcc
cggctctgcagccgcgacagctcctgcactcctggcgcggccaagggcggcgcgaatggc
gagtgcgggcgcggggagccgcagtgcagccccgagggccccgcgcgcggccccaaggtt
tcgttctcatgtcgcggggcggcctcggggcccgcggcggccgaggaggcgggcagcgag
gaggcgggcccggcgggtgagccgcgcggcagccaggccagcttcctgcagcgccaattc
ggggcgctcctgcagccgggcgtcaacaagttctccctgcggatgtttggcagccagaag
gccgtggagcgcgagcaggaacgcgtgaagtcggcgggggcctggatcatccacccctac
agcgacttcaggttctactgggacttcaccatgctgttgttcatggtgggaaatctcatc
atcatccctgtgggcatcactttcttcaaggacgagaccacggcgccctggatcgtcttc
aacgtggtctcggacactttcttcctcatggacttggtgctgaactttcgcaccggcatt
gttattgaggacaacacggagatcatcctggaccccgaaaagataaagaaaaagtacctg
cgtacgtggttcgtggtagacttcgtgtcatccatcccggtggactacatcttcctcatc
gtggagaagggaatcgactccgaggtctacaagacggcccgtgcactacgcatcgtgcgt
ttcaccaagatcctcagtctgctgcggttgctgcggctatcccggctcatccgatatatc
caccaatgggaggagattttccacatgacctacgacctggcaagcgcggtgatgcgcatc
tgtaacctgatcagcatgatgctgctgctctgccactgggacggctgcctgcagttcctg
gtgcccatgctgcaagacttccccagcgactgctgggtgtccatcaacaacatggtgaac
cactcgtggagcgaactctattcgttcgcgctcttcaaggccatgagccacatgctctgt
attggctacgggcggcaggctcccgagagcatgacggacatctggctcaccatgctcagc
atgatcgtgggcgccacctgctacgctatgttcattgggcacgccacggcgcttatccag
tccctggactcgtcacggcgccagtaccaggagaagtacaagcaagtggagcagtacatg
tccttccacaaactgccggctgacttccgccagaagatccacgattactatgaacaccgg
taccaggggaagatgtttgacgaggacagcatcctgggggaactcaacggcccactgcgt
gaggagattgtgaacttcaactgccggaagctggtggcttccatgccgttgtttgccaac
gcagaccccaacttcgtcaccgccatgctgacaaagctcaaatttgaggtcttccagcct
ggagactacatcatccgagaggggaccatcgggaagaagatgtacttcatccagcacggg
gtggtgagcgtgctcaccaagggcaacaaggagatgaagctgtcagatggctcctatttt
ggggagatctgcctgctcacgaggggccggcgcacagccagtgtgcgggctgacacctac
tgtcgcctctactcactgagcgtggacaacttcaacgaggtgctggaggagtaccccatg
atgcggcgtgcctttgagaccgtggccattgaccgcctggaccgcataggcaagaagaac
tccatcttgctacacaaggttcagcatgatctcagctcgggtgtgttcaacaaccaggag
aacgccatcatccaggagattgtcaaatatgaccgtgagatggtgcagcaggcagagctg
ggccagcgtgtggggctcttcccaccaccgccaccaccgcaggtcacgtcggccatcgcc
acactgcagcaggccgtggccatgagcttctgcccgcaggtggcccgcccgctcgtgggg
cccctggcgctagggtccccacgcctcgtgcgccgcgcgcccccagggcctctgcctcct
gcagcctcaccagggccacccgcagcgagccccccggctgcaccctcgagccctcgggca
ccgcggacctcaccctacggtgtgcctggctctccggcaacgcgtgtggggcccgcattg
cccgcacgccgcctgagccgcgcctcgcgcccactgtccgcctcgcagccctcgctgccc
cacggcgcgcccgcacccagccccgcggcctctgcgcgcccggccagcagctccaccccg
cgtctgggacccgcacccaccacccggaccgcggcacccagtccggaccgcagggactca
gcctcgccgggcgctgccagtggcctcgacccactggactctgcgcgctcgcgcctctct
tccaacttgtga

DBGET integrated database retrieval system